Sequence 1: | NP_477049.2 | Gene: | Gp150 / 37549 | FlyBaseID: | FBgn0013272 | Length: | 1076 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001305406.1 | Gene: | TSKU / 25987 | HGNCID: | 28850 | Length: | 367 | Species: | Homo sapiens |
Alignment Length: | 348 | Identity: | 88/348 - (25%) |
---|---|---|---|
Similarity: | 141/348 - (40%) | Gaps: | 96/348 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 370 LTISGNDL-----SVMSSIHYLLKSSSIEELDFSRNNLMELNPKAFSHLSNVVYINLSQNSLKKL 429
Fly 430 PEKAFEKVTLLEELDLSYNSLTELPRDIFNGTTLS---ILH--LKYNTFNGDLHFGTK------D 483
Fly 484 LQQLDLSFNSIVQVHHSMFDKMPGLTN-----LNLKGNGIKKIQPDSFLTLKNLRHIDLSINDLD 543
Fly 544 QISGMLFFKNSELDVIRLNDNPRLSQLPTDGFLSYSGEFTVYYLDISNCAIGPLGHKAFSTMPHL 608
Fly 609 TTLKLAWN-NINHLPREIFTGLHKLIDLDLSNNLITRMDDLIFMDNGELTKLSLAGNPISRLSVR 672
Fly 673 L--------FLPLHQLRCLDVND 687 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gp150 | NP_477049.2 | LRR_8 | 317..377 | CDD:290566 | 3/6 (50%) |
leucine-rich repeat | 343..366 | CDD:275380 | |||
leucine-rich repeat | 367..391 | CDD:275380 | 7/25 (28%) | ||
LRR_RI | <374..619 | CDD:238064 | 66/266 (25%) | ||
LRR_8 | 390..450 | CDD:290566 | 21/59 (36%) | ||
leucine-rich repeat | 393..415 | CDD:275380 | 10/21 (48%) | ||
leucine-rich repeat | 416..439 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 440..483 | CDD:275380 | 15/53 (28%) | ||
leucine-rich repeat | 463..481 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 484..542 | CDD:290566 | 18/62 (29%) | ||
leucine-rich repeat | 484..507 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 508..531 | CDD:275380 | 9/27 (33%) | ||
leucine-rich repeat | 532..569 | CDD:275380 | 4/36 (11%) | ||
leucine-rich repeat | 556..583 | CDD:275380 | 3/26 (12%) | ||
leucine-rich repeat | 570..607 | CDD:275380 | 5/36 (14%) | ||
LRR_RI | <586..745 | CDD:238064 | 28/111 (25%) | ||
LRR_8 | 606..666 | CDD:290566 | 17/60 (28%) | ||
leucine-rich repeat | 608..631 | CDD:275380 | 9/23 (39%) | ||
leucine-rich repeat | 632..655 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 656..674 | CDD:275380 | 5/25 (20%) | ||
leucine-rich repeat | 733..745 | CDD:275378 | |||
TSKU | NP_001305406.1 | LRR_RI | 52..305 | CDD:238064 | 78/293 (27%) |
leucine-rich repeat | 76..99 | CDD:275380 | 7/25 (28%) | ||
leucine-rich repeat | 100..123 | CDD:275380 | 10/22 (45%) | ||
LRR_8 | 103..157 | CDD:290566 | 21/54 (39%) | ||
leucine-rich repeat | 124..145 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 147..170 | CDD:275380 | 9/24 (38%) | ||
leucine-rich repeat | 171..197 | CDD:275380 | 5/25 (20%) | ||
leucine-rich repeat | 200..219 | CDD:275380 | 7/26 (27%) | ||
LRR_8 | 221..279 | CDD:290566 | 21/108 (19%) | ||
leucine-rich repeat | 221..244 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 245..269 | CDD:275380 | 9/74 (12%) | ||
LRR_8 | 268..321 | CDD:290566 | 16/52 (31%) | ||
leucine-rich repeat | 270..294 | CDD:275380 | 9/23 (39%) | ||
leucine-rich repeat | 295..316 | CDD:275380 | 5/20 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45617 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |