DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wdp and LRRC3

DIOPT Version :9

Sequence 1:NP_001286712.1 Gene:wdp / 37548 FlyBaseID:FBgn0034718 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_112153.1 Gene:LRRC3 / 81543 HGNCID:14965 Length:257 Species:Homo sapiens


Alignment Length:212 Identity:53/212 - (25%)
Similarity:81/212 - (38%) Gaps:63/212 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFLIVVANATPTPARTPTGCPADCT-CSLSQHTHKPLYHLKCNSTRGLRLTEKTFQSTVPVHSID 75
            ||.:.:..|.|.|.|.|....|... |||                |||    :.....:|.::: 
Human    24 LFCLHLGAACPQPCRCPDHAGAVAVFCSL----------------RGL----QEVPEDIPANTV- 67

  Fly    76 LSHLNLTRLSHLLD----KLPELTSADLSHNQLKDLGH-----LGKGLKRLNLKHN---QLTSDK 128
            |..|:..::|||.|    .|..|...|||||.::.:|.     |..||:.|:|.:|   ::..|.
Human    68 LLKLDANKISHLPDGAFQHLHRLRELDLSHNAIEAIGSATFAGLAGGLRLLDLSYNRIQRIPKDA 132

  Fly   129 LRKLPQHLQVLNLQHNNITHLPLELTHMHQLHQLELSHNAINCSCQTLEVRNWLVERIVYMEHPV 193
            |.||..                          ::.||||.::|.| .|:...|.::........:
Human   133 LGKLSA--------------------------KIRLSHNPLHCEC-ALQEALWELKLDPDSVDEI 170

  Fly   194 VC--SYPLEFRGRSWLQ 208
            .|  |...||.|:..:|
Human   171 ACHTSVQEEFVGKPLVQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdpNP_001286712.1 LRR_RI <31..176 CDD:238064 38/157 (24%)
leucine-rich repeat 47..70 CDD:275378 3/22 (14%)
LRR_8 71..124 CDD:290566 20/64 (31%)
leucine-rich repeat 73..93 CDD:275378 7/23 (30%)
leucine-rich repeat 94..112 CDD:275378 8/22 (36%)
LRR_8 112..169 CDD:290566 13/59 (22%)
leucine-rich repeat 114..134 CDD:275378 8/22 (36%)
leucine-rich repeat 136..158 CDD:275378 0/21 (0%)
leucine-rich repeat 159..171 CDD:275378 4/11 (36%)
LRRC3NP_112153.1 LRRNT 32..68 CDD:214470 13/56 (23%)
leucine-rich repeat 48..65 CDD:275378 7/36 (19%)
LRR 1 65..86 6/21 (29%)
leucine-rich repeat 66..89 CDD:275378 7/23 (30%)
LRR_8 69..125 CDD:290566 19/55 (35%)
LRR_4 69..103 CDD:289563 12/33 (36%)
LRR_4 89..129 CDD:289563 13/39 (33%)
LRR 2 89..110 7/20 (35%)
leucine-rich repeat 90..114 CDD:275378 8/23 (35%)
LRR 3 114..135 7/20 (35%)
leucine-rich repeat 115..138 CDD:275378 8/22 (36%)
LRR 4 136..157 8/47 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24369
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.