DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wdp and mxra5b

DIOPT Version :10

Sequence 1:NP_611661.1 Gene:wdp / 37548 FlyBaseID:FBgn0034718 Length:677 Species:Drosophila melanogaster
Sequence 2:XP_068079803.1 Gene:mxra5b / 795448 ZFINID:ZDB-GENE-081104-119 Length:2548 Species:Danio rerio


Alignment Length:887 Identity:158/887 - (17%)
Similarity:280/887 - (31%) Gaps:352/887 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TAWLALFLIVVANATPTPARTPTGCPADCTCSLSQHTH---KPLYHLKCNSTRGLRLTEKTFQST 68
            ::||.|.:::|:....:..     ||..|.||.....|   :.|..:....::.::.....|.:.
Zfish     3 SSWLFLLVLLVSFGLCSGV-----CPRQCACSAPAEVHCTFRALLAVPAGISKQVQRINFGFNTI 62

  Fly    69 VPVHSIDLSHLNLTRLSHLL------DKLPELTSADL--------SHNQL---KDLGHLG-KGLK 115
            ..:  .|.|...|.:|..|:      .|:|:....||        |:|:|   .|....| .|:.
Zfish    63 SQI--TDASFSGLRKLELLMMHGNNVQKIPDGAFQDLVSLQVLKMSYNKLTVITDRTFSGLTGII 125

  Fly   116 RLNLKHNQLTSDKLRKLPQ------HLQVLNLQHNNITHL--------------PLE-LTHMH-- 157
            ||:|.||.::|..    ||      .|::|:|:.|.:..|              |:. |.|:|  
Zfish   126 RLHLDHNHISSIH----PQAFLGLTSLRLLHLEANRLQQLHPHTFSTFSVLRRFPVSTLKHLHIS 186

  Fly   158 ----------------QLHQLELSHNAINCSCQTLEVRNWLVERIVYMEHPVV------------ 194
                            ||..|.|:.|..:|.|:...:::|..      .||.|            
Zfish   187 DNLLQTLSRSVLENTPQLETLLLTGNPWSCDCRMRWLQDWSA------RHPGVMKCKKDRTFTSG 245

  Fly   195 -----CSYPLEFRGRSWLQLKQDEICKKEKYQWFDTEENELMMGDQPAAVSAEREDEEELGKDFL 254
                 |:.|...:....|.|||                   ::...|:.:|..|...||...:.|
Zfish   246 QLCPLCASPKHLKAADMLDLKQ-------------------LVCSGPSIISPGRNISEEDTSELL 291

  Fly   255 PI------VGNPAATAK-----------KVRSPQ--------------------------IPLPS 276
            ||      .||.:.|..           ::..||                          .|:..
Zfish   292 PIDRIKPAFGNVSFTLSDEHGTKVDLICQILQPQDSTTISWNHTKSLQIAANVTLVLDVECPVSR 356

  Fly   277 DQVEGSGDL----SETNMELK----------------------------LPEETVAEPEAAESQL 309
            |..|....|    ||..:.|:                            |....:|.|......|
Zfish   357 DDYESFWRLLAYYSEAPVHLRREIMLRREPALSYRYRQDAEKDGFFYTSLKANVLAHPSWLMQSL 421

  Fly   310 VDA------AASPSV---LEEHIVKDEDEDDEGS-----------------------------GS 336
            :..      :.|.||   |...:..:.||::..|                             .|
Zfish   422 ISIKLNRPYSTSKSVRLILSTQLTANADEENVRSWVMIENDNKTQTSFASVVGGVAEMHCRVQSS 486

  Fly   337 GGGLL--IIPDPSKVK--ITSED---DIDSDGKPEESDVRPLENPENSENPDTVFSNKIGIY--- 391
            |..::  ::|:.||||  .:|.|   .|.|.||   .:::.:|:.::            |:|   
Zfish   487 GNAVIYWMLPNGSKVKSAFSSVDGRVSISSSGK---LNIKTIEHRDS------------GVYYCI 536

  Fly   392 ---EGDQE----EKKPVEEDNIVP------------------VVMTNLDTGLESD-VVTDGPLDS 430
               :||.:    ....:|..|.:|                  ..:|......|.: |:.||    
Zfish   537 AEVDGDVDVLPFRLSVIESSNPLPNQEVGNSLSRFIGQSAFLTCLTKASPDAEINWVLPDG---- 597

  Fly   431 SKESEDILTAKIGKPKDDSSAIYYLLAVIGLIVVGLVLFVAIKRCKYDSN-----AAARDAEAQR 490
                 ::|.||....:             .|:.....|::.:  |:.:.|     .|..:.....
Zfish   598 -----NVLNAKANTSR-------------ALLFPNGTLYIPV--CQLNDNGYYKCVAMNNHGVDV 642

  Fly   491 QTELLDMDKKQLGKPLHKNGHGNGQEHSPLIGEKTKLDEAQIVKKPYENGEAKDGAGQQPLLNGN 555
            .:..|.:.:::|.:||.:         .|:|..::....:..||...|:.|              
Zfish   643 FSTKLTVIRRKLIQPLRQ---------YPIIRPQSAAGVSTKVKAFLEDME-------------- 684

  Fly   556 GSANGGTKEAPET----GEPAAHEYYPITPRYPTPQSPRASKYAQQQQLAEQNNNEPDGAYLPSS 616
             .|:|...|...|    ..|.|..:..|  |:..|...||. ...|:.:..:|..:|.       
Zfish   685 -EASGDISETRLTPTRRRRPNARRFGNI--RHRRPFRNRAG-LPNQRPVNTKNKIDPQ------- 738

  Fly   617 PKSGRYSPVYSPETGRVKIKLTETPKPKTPMLVTRSKSNAGD 658
                :::.:.|    :::.|.:|:.|.....|:..::|::||
Zfish   739 ----KWADLLS----KIRAKTSESNKSLQSGLIDNTESSSGD 772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdpNP_611661.1 leucine-rich repeat 47..70 CDD:275378 2/22 (9%)
LRR <72..>169 CDD:443914 37/153 (24%)
leucine-rich repeat 73..93 CDD:275378 6/25 (24%)
leucine-rich repeat 94..112 CDD:275378 7/29 (24%)
leucine-rich repeat 114..134 CDD:275378 6/19 (32%)
leucine-rich repeat 136..158 CDD:275378 9/54 (17%)
leucine-rich repeat 159..171 CDD:275378 4/11 (36%)
mxra5bXP_068079803.1 leucine-rich repeat 33..51 CDD:275380 2/17 (12%)
LRR <45..>213 CDD:443914 37/173 (21%)
leucine-rich repeat 52..75 CDD:275380 4/24 (17%)
leucine-rich repeat 76..99 CDD:275380 6/22 (27%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
leucine-rich repeat 124..147 CDD:275380 8/26 (31%)
leucine-rich repeat 148..179 CDD:275380 6/30 (20%)
leucine-rich repeat 180..203 CDD:275380 3/22 (14%)
LRRCT 212..>258 CDD:214507 9/51 (18%)
FR1 465..482 CDD:409355 0/16 (0%)
Ig strand A' 470..472 CDD:409355 0/1 (0%)
IG_like 472..552 CDD:214653 18/94 (19%)
Ig strand B 475..483 CDD:409355 0/7 (0%)
CDR1 483..489 CDD:409355 2/5 (40%)
Ig strand D 512..517 CDD:409355 1/4 (25%)
FR3 513..537 CDD:409355 7/38 (18%)
Ig strand F 531..538 CDD:409355 2/6 (33%)
CDR3 538..547 CDD:409355 2/8 (25%)
Ig 573..639 CDD:472250 13/89 (15%)
Ig strand B 576..580 CDD:409353 0/3 (0%)
Ig strand C 589..593 CDD:409353 1/3 (33%)
Ig strand E 615..619 CDD:409353 1/3 (33%)
Ig strand F 629..634 CDD:409353 0/4 (0%)
IG_like 1583..1666 CDD:214653
Ig strand B 1592..1596 CDD:143223
Ig strand C 1605..1609 CDD:143223
Ig strand E 1632..1636 CDD:143223
Ig strand F 1646..1651 CDD:143223
Ig 1679..1763 CDD:472250
Ig strand B 1689..1693 CDD:409353
Ig strand C 1702..1710 CDD:409353
Ig strand E 1729..1733 CDD:409353
Ig strand F 1743..1748 CDD:409353
Ig strand G 1756..1759 CDD:409353
Ig 1777..1860 CDD:472250
Ig strand B 1786..1790 CDD:409353
Ig strand C 1799..1804 CDD:409353
Ig strand E 1826..1830 CDD:409353
Ig strand F 1840..1845 CDD:409353
Ig strand G 1853..1856 CDD:409353
IG_like 1882..1959 CDD:214653
Ig strand B 1885..1889 CDD:409353
Ig strand C 1898..1902 CDD:409353
Ig strand E 1925..1929 CDD:409353
Ig strand F 1939..1944 CDD:409353
Ig 1970..2062 CDD:472250
Ig strand B 1982..1986 CDD:409353
Ig strand C 1995..2004 CDD:409353
Ig strand E 2028..2032 CDD:409353
Ig strand F 2042..2047 CDD:409353
Ig strand G 2055..2058 CDD:409353
Ig 2075..2156 CDD:472250
Ig strand B 2085..2089 CDD:409353
Ig strand C 2098..2102 CDD:409353
Ig strand E 2122..2126 CDD:409353
Ig strand F 2136..2141 CDD:409353
Ig 2175..2255 CDD:472250
Ig strand B 2182..2186 CDD:409353
Ig strand C 2195..2199 CDD:409353
Ig strand E 2221..2225 CDD:409353
Ig strand F 2235..2240 CDD:409353
Ig strand G 2248..2251 CDD:409353
Ig_3 2261..2340 CDD:464046
Ig_3 2356..2435 CDD:464046
Ig_3 2452..2534 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.