DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wdp and RTN4R

DIOPT Version :9

Sequence 1:NP_001286712.1 Gene:wdp / 37548 FlyBaseID:FBgn0034718 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_075380.1 Gene:RTN4R / 65078 HGNCID:18601 Length:473 Species:Homo sapiens


Alignment Length:434 Identity:92/434 - (21%)
Similarity:136/434 - (31%) Gaps:173/434 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTAWLALFLIVVANATPTPARTPTGCPADCTCSLSQHTHKPLYHLKCNSTRGLRLTEKTFQSTVP 70
            |.||: |:|.....|.|        ||..|.|     .::|.....| ..:||:        .||
Human    11 LLAWV-LWLQAWQVAAP--------CPGACVC-----YNEPKVTTSC-PQQGLQ--------AVP 52

  Fly    71 V-----------HSIDLSHL---------NLTRL---SHLLDK--------LPELTSADLSHN-Q 103
            |           |...:||:         |||.|   |::|.:        |..|...|||.| |
Human    53 VGIPAASQRIFLHGNRISHVPAASFRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQ 117

  Fly   104 LKD---------------------LGHLGKGLKR--------------------------LNLKH 121
            |:.                     |..||.||.|                          .||.|
Human   118 LRSVDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRDLGNLTH 182

  Fly   122 NQLTSDKLRKLPQ-------------------------------HLQVLNLQHNNITHLPLE-LT 154
            ..|..:::..:|:                               .|..|.|..||::.||.| |.
Human   183 LFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSALPTEALA 247

  Fly   155 HMHQLHQLELSHNAINCSCQTLEVRNWLVERIVYMEHPVVCSYPLEFRGRSWLQLKQDEICKKEK 219
            .:..|..|.|:.|...|.|:...:..|| ::.......|.||.|....||...:|..:       
Human   248 PLRALQYLRLNDNPWVCDCRARPLWAWL-QKFRGSSSEVPCSLPQRLAGRDLKRLAAN------- 304

  Fly   220 YQWFDTEENELMMGDQPAAVSAEREDEEELG---------KDFLPIV--GNPAATAKKVRSPQIP 273
                |.:...:..|......:....|||.||         .|...::  |.||:....::. ::|
Human   305 ----DLQGCAVATGPYHPIWTGRATDEEPLGLPKCCQPDAADKASVLEPGRPASAGNALKG-RVP 364

  Fly   274 LPSDQVEGSGD----LSET-------NMELKLPEETVAEPEAAE 306
             |.|...|:|.    ::::       :.|   |..|...||.:|
Human   365 -PGDSPPGNGSGPRHINDSPFGTLPGSAE---PPLTAVRPEGSE 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdpNP_001286712.1 LRR_RI <31..176 CDD:238064 54/255 (21%)
leucine-rich repeat 47..70 CDD:275378 3/22 (14%)
LRR_8 71..124 CDD:290566 27/131 (21%)
leucine-rich repeat 73..93 CDD:275378 9/39 (23%)
leucine-rich repeat 94..112 CDD:275378 9/39 (23%)
LRR_8 112..169 CDD:290566 21/114 (18%)
leucine-rich repeat 114..134 CDD:275378 6/45 (13%)
leucine-rich repeat 136..158 CDD:275378 9/22 (41%)
leucine-rich repeat 159..171 CDD:275378 4/11 (36%)
RTN4RNP_075380.1 LRR 1. /evidence=ECO:0000255 55..79 3/23 (13%)
leucine-rich repeat 60..82 CDD:275380 3/21 (14%)
LRR 2. /evidence=ECO:0000255 81..103 6/21 (29%)
LRR_8 82..142 CDD:338972 14/59 (24%)
leucine-rich repeat 83..106 CDD:275380 6/22 (27%)
LRR 3. /evidence=ECO:0000255 104..128 8/23 (35%)
leucine-rich repeat 107..131 CDD:275380 7/23 (30%)
LRR 4. /evidence=ECO:0000255 129..152 5/22 (23%)
leucine-rich repeat 132..155 CDD:275380 6/22 (27%)
LRR 5. /evidence=ECO:0000255 153..176 0/22 (0%)
LRR_8 156..214 CDD:338972 5/57 (9%)
leucine-rich repeat 156..179 CDD:275380 0/22 (0%)
LRR 6. /evidence=ECO:0000255 178..200 5/21 (24%)
leucine-rich repeat 180..203 CDD:275380 4/22 (18%)
LRR 7. /evidence=ECO:0000255 202..224 0/21 (0%)
LRR_8 203..261 CDD:338972 12/57 (21%)
leucine-rich repeat 204..227 CDD:275380 0/22 (0%)
LRR 8. /evidence=ECO:0000255 225..248 9/22 (41%)
leucine-rich repeat 228..251 CDD:275380 9/22 (41%)
LRR 9. /evidence=ECO:0000255 250..273 6/22 (27%)
TPKR_C2 260..>296 CDD:387596 9/36 (25%)
DUF390 332..>417 CDD:282014 15/78 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 346..447 14/64 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24369
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.