DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wdp and LRRC4

DIOPT Version :9

Sequence 1:NP_001286712.1 Gene:wdp / 37548 FlyBaseID:FBgn0034718 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_071426.1 Gene:LRRC4 / 64101 HGNCID:15586 Length:653 Species:Homo sapiens


Alignment Length:346 Identity:69/346 - (19%)
Similarity:111/346 - (32%) Gaps:147/346 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VHLTAWLALFL----------IVVANATPTPARTPTGCPADCTCS-------------------- 38
            ||...|.|:.|          |:.|......:..|..||:.|:||                    
Human     9 VHHHTWNAILLPFVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGI 73

  Fly    39 ----------------LSQHTHKPLYHLKC-----NSTRGLRLTEKTFQSTVPVHSIDLSHLNLT 82
                            :...|.:.|:||:.     ||.|.:.:  ..|.....:::::|....||
Human    74 PSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEV--GAFNGLASLNTLELFDNWLT 136

  Fly    83 RL-------------------------SHLLDKLPELTSADLSHNQLKDLGHLGKGLKR--LNLK 120
            .:                         |:..:::|.|...||  .:||.|.::.:|...  .|||
Human   137 VIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDL--GELKKLEYISEGAFEGLFNLK 199

  Fly   121 HNQLTSDKLRKLP--------QHLQV--------------------------------------- 138
            :..|....::.:|        :.|::                                       
Human   200 YLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDG 264

  Fly   139 ------LNLQHNNITHLPLEL-THMHQLHQLELSHNAINCSCQTLEVRNWLVERIVYMEHPV--- 193
                  |||.|||::.||.:| |.:..|.:|.|.||..||.|..|.:..||.|.|     |.   
Human   265 LASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYI-----PTNST 324

  Fly   194 ---VCSYPLEFRGRSWLQLKQ 211
               .|..|:..|||..:::.|
Human   325 CCGRCHAPMHMRGRYLVEVDQ 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdpNP_001286712.1 LRR_RI <31..176 CDD:238064 49/266 (18%)
leucine-rich repeat 47..70 CDD:275378 7/27 (26%)
LRR_8 71..124 CDD:290566 15/79 (19%)
leucine-rich repeat 73..93 CDD:275378 4/44 (9%)
leucine-rich repeat 94..112 CDD:275378 6/17 (35%)
LRR_8 112..169 CDD:290566 22/112 (20%)
leucine-rich repeat 114..134 CDD:275378 5/29 (17%)
leucine-rich repeat 136..158 CDD:275378 11/67 (16%)
leucine-rich repeat 159..171 CDD:275378 5/11 (45%)
LRRC4NP_071426.1 LRRNT 46..79 CDD:214470 5/32 (16%)
LRR <74..291 CDD:227223 36/220 (16%)
LRR 1 76..97 1/20 (5%)
leucine-rich repeat 77..100 CDD:275380 2/22 (9%)
LRR 2 100..121 6/22 (27%)
leucine-rich repeat 101..124 CDD:275380 5/24 (21%)
LRR 3 124..145 3/20 (15%)
leucine-rich repeat 125..148 CDD:275380 3/22 (14%)
LRR 4 148..169 1/20 (5%)
leucine-rich repeat 149..172 CDD:275380 1/22 (5%)
LRR 5 172..194 7/23 (30%)
leucine-rich repeat 173..197 CDD:275380 7/25 (28%)
LRR 6 197..218 5/20 (25%)
leucine-rich repeat 198..219 CDD:275380 4/20 (20%)
LRR 7 219..240 1/20 (5%)
leucine-rich repeat 220..243 CDD:275380 1/22 (5%)
LRR 8 243..264 0/20 (0%)
leucine-rich repeat 244..267 CDD:275380 0/22 (0%)
LRR 9 267..288 9/20 (45%)
leucine-rich repeat 268..289 CDD:275380 10/20 (50%)
LRRCT 300..351 CDD:214507 16/51 (31%)
IG 359..441 CDD:214652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24369
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.