| Sequence 1: | NP_001286712.1 | Gene: | wdp / 37548 | FlyBaseID: | FBgn0034718 | Length: | 677 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001093494.1 | Gene: | lrrc4.2 / 566572 | ZFINID: | ZDB-GENE-030131-7997 | Length: | 644 | Species: | Danio rerio |
| Alignment Length: | 493 | Identity: | 99/493 - (20%) |
|---|---|---|---|
| Similarity: | 153/493 - (31%) | Gaps: | 200/493 - (40%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 VHLTAWLALFLIVV--------ANATPTPARTPTGCPADCTCS---------------------- 38
Fly 39 LSQH--------------THKPLYHLKC-----NSTRGLRLTEKTFQSTVPVHSIDLSHLNLTRL 84
Fly 85 -------------------------SHLLDKLPELTSADLSHNQLKDLGHLGKG-LKRL-NLKHN 122
Fly 123 QLTSDKLRKLP--------QHLQV----------------------------------------- 138
Fly 139 ----LNLQHNNITHLPLEL-THMHQLHQLELSHNAINCSCQTLEVRNWLVERIVYMEHPV----- 193
Fly 194 -VCSYPLEFRGRSWLQLKQDEICKKEKYQWFDTEENELMMGDQPAAVSAEREDEEELGKDFLP-- 255
Fly 256 ----IVGNPAATAKKVRSPQIP------------LPSD-------------QVEGSGDLSETNME 291
Fly 292 LK------LPEETVAEPEAAESQLV---DAAASPSVLE 320 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| wdp | NP_001286712.1 | LRR_RI | <31..176 | CDD:238064 | 50/266 (19%) |
| leucine-rich repeat | 47..70 | CDD:275378 | 7/27 (26%) | ||
| LRR_8 | 71..124 | CDD:290566 | 15/79 (19%) | ||
| leucine-rich repeat | 73..93 | CDD:275378 | 4/44 (9%) | ||
| leucine-rich repeat | 94..112 | CDD:275378 | 5/17 (29%) | ||
| LRR_8 | 112..169 | CDD:290566 | 24/112 (21%) | ||
| leucine-rich repeat | 114..134 | CDD:275378 | 8/28 (29%) | ||
| leucine-rich repeat | 136..158 | CDD:275378 | 10/67 (15%) | ||
| leucine-rich repeat | 159..171 | CDD:275378 | 5/11 (45%) | ||
| lrrc4.2 | NP_001093494.1 | leucine-rich repeat | 71..94 | CDD:275380 | 3/22 (14%) |
| LRR_8 | 72..129 | CDD:290566 | 10/58 (17%) | ||
| LRR_RI | 74..>276 | CDD:238064 | 34/205 (17%) | ||
| leucine-rich repeat | 95..118 | CDD:275380 | 5/24 (21%) | ||
| leucine-rich repeat | 119..142 | CDD:275380 | 3/22 (14%) | ||
| LRR_8 | 141..202 | CDD:290566 | 13/62 (21%) | ||
| leucine-rich repeat | 143..166 | CDD:275380 | 1/22 (5%) | ||
| leucine-rich repeat | 167..191 | CDD:275380 | 7/25 (28%) | ||
| leucine-rich repeat | 192..213 | CDD:275380 | 6/20 (30%) | ||
| LRR_8 | 213..272 | CDD:290566 | 6/58 (10%) | ||
| leucine-rich repeat | 214..237 | CDD:275380 | 1/22 (5%) | ||
| leucine-rich repeat | 238..261 | CDD:275380 | 0/22 (0%) | ||
| leucine-rich repeat | 262..283 | CDD:275380 | 9/20 (45%) | ||
| LRRCT | 294..345 | CDD:214507 | 15/64 (23%) | ||
| IG_like | 353..435 | CDD:214653 | 15/83 (18%) | ||
| Ig | 365..435 | CDD:299845 | 11/69 (16%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24369 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||