DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wdp and chp

DIOPT Version :9

Sequence 1:NP_001286712.1 Gene:wdp / 37548 FlyBaseID:FBgn0034718 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster


Alignment Length:320 Identity:72/320 - (22%)
Similarity:119/320 - (37%) Gaps:110/320 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NSTRGLRLTE----KTFQSTVPVHSIDLSHLNLTRLSHLLD---------------KLPELTSAD 98
            :|...|.|.|    ..|.||  :||:|||  |..|....||               .:|:|...|
  Fly   845 SSLAALTLCELHLSNNFIST--IHSMDLS--NKFRSLRYLDISYNYLLRIDDAVFATMPKLAVLD 905

  Fly    99 LSHN---QLKDLGHLG-----------------------KGLKRLNLKHNQLTSDKLRKLPQ--- 134
            ||||   ::.|...:|                       |.|:...|.:|:|.|     :||   
  Fly   906 LSHNRDLKVMDKSFMGLENSLIKLGLENISLSTVPEIRLKYLREFRLGYNELPS-----IPQELA 965

  Fly   135 ----HLQVLNLQHNNITHLPLELTHMHQLHQLELSHN-----------AINCSCQTLEVRNWLVE 184
                :|::|:|.:|::|::||....:..|.:|.||.|           .:|...:.|::.|:   
  Fly   966 HNMSNLRMLDLSNNDLTNVPLMTQALPHLRRLMLSGNPITSLNNNSFDGVNEDLEMLDISNF--- 1027

  Fly   185 RIVYMEHPVVCSYP----LEFRGRSWLQLKQDEICKKEKYQ----WFDTEENELMMGDQPAAVSA 241
            |:.|.|:..:.|.|    |:....|.|:........:..|.    |.:        ..||     
  Fly  1028 RLHYFEYGCLDSLPHLRSLKLTAYSHLEHFNIPHLLRHHYNIRQLWIE--------APQP----- 1079

  Fly   242 EREDEEELGKDFLPIVGNPAATAKKVRSPQIPLPSD---QVEGSGDLSETNMELKLPEET 298
                       |..||...:...:::::.|:..|:|   ::||......||:....|:.|
  Fly  1080 -----------FTRIVKKGSGPTQEMQTLQLGNPTDLQREMEGHLPSKLTNITFSGPQFT 1128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdpNP_001286712.1 LRR_RI <31..176 CDD:238064 46/185 (25%)
leucine-rich repeat 47..70 CDD:275378 7/20 (35%)
LRR_8 71..124 CDD:290566 22/93 (24%)
leucine-rich repeat 73..93 CDD:275378 8/34 (24%)
leucine-rich repeat 94..112 CDD:275378 8/43 (19%)
LRR_8 112..169 CDD:290566 20/74 (27%)
leucine-rich repeat 114..134 CDD:275378 5/19 (26%)
leucine-rich repeat 136..158 CDD:275378 7/21 (33%)
leucine-rich repeat 159..171 CDD:275378 5/22 (23%)
chpNP_001263137.1 leucine-rich repeat 84..103 CDD:275380
LRR_8 102..163 CDD:290566
leucine-rich repeat 104..128 CDD:275380
LRR_RI <128..261 CDD:238064
leucine-rich repeat 129..152 CDD:275380
LRR_8 152..212 CDD:290566
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR_8 202..261 CDD:290566
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
LRR_8 326..386 CDD:290566
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 426..450 CDD:275378
LRR_RI <448..651 CDD:238064
leucine-rich repeat 451..474 CDD:275380
LRR_8 473..559 CDD:290566
leucine-rich repeat 475..524 CDD:275380
leucine-rich repeat 500..519 CDD:275380
leucine-rich repeat 525..548 CDD:275380
leucine-rich repeat 549..574 CDD:275380
LRR_8 573..633 CDD:290566
leucine-rich repeat 575..598 CDD:275380
leucine-rich repeat 599..622 CDD:275380
LRR_8 622..683 CDD:290566
leucine-rich repeat 623..646 CDD:275380
leucine-rich repeat 647..730 CDD:275380
leucine-rich repeat 648..673 CDD:275380
leucine-rich repeat 674..705 CDD:275380
LRR_8 704..763 CDD:290566
leucine-rich repeat 731..754 CDD:275380
LRR_8 753..813 CDD:290566
leucine-rich repeat 755..778 CDD:275380
leucine-rich repeat 779..802 CDD:275380
leucine-rich repeat 803..823 CDD:275380
leucine-rich repeat 852..876 CDD:275380 11/27 (41%)
LRR_8 854..910 CDD:290566 19/59 (32%)
LRR_RI <877..>1006 CDD:238064 31/133 (23%)
leucine-rich repeat 877..900 CDD:275380 2/22 (9%)
leucine-rich repeat 901..925 CDD:275380 8/23 (35%)
leucine-rich repeat 926..946 CDD:275380 0/19 (0%)
LRR_8 947..1004 CDD:290566 19/61 (31%)
leucine-rich repeat 947..970 CDD:275380 7/27 (26%)
leucine-rich repeat 971..993 CDD:275380 7/21 (33%)
LRR_8 992..1049 CDD:290566 14/59 (24%)
leucine-rich repeat 994..1014 CDD:275380 5/19 (26%)
leucine-rich repeat 1019..1042 CDD:275380 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24369
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.