DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wdp and Lrrc3

DIOPT Version :9

Sequence 1:NP_001286712.1 Gene:wdp / 37548 FlyBaseID:FBgn0034718 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_660134.1 Gene:Lrrc3 / 237387 MGIID:2447899 Length:257 Species:Mus musculus


Alignment Length:275 Identity:61/275 - (22%)
Similarity:106/275 - (38%) Gaps:70/275 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RTPTGCPADCTCSLSQHTHKPLYHLKCNSTRGLRLTEKTFQSTVPVHSIDLSHLNLTRLSHL--- 87
            |....||..|.|.    .|.....:.| |:|||    :.....:|..:: |..|:..|:|.:   
Mouse    28 RLGASCPQACQCP----DHAGAVAVHC-SSRGL----QEIPRDIPADTV-LLKLDANRISRVPNG 82

  Fly    88 -LDKLPELTSADLSHNQLKDLG-----HLGKGLKRLNLKHNQLTSDKLRKLPQH-LQVLNLQHNN 145
             ...||:|...|||||.::.:|     .|..||:.|:|.||     ::|::|:. |..|:.    
Mouse    83 AFQHLPQLRELDLSHNAIEAIGPAAFSGLAGGLRLLDLSHN-----RIRRIPKDALGKLSA---- 138

  Fly   146 ITHLPLELTHMHQLHQLELSHNAINCSCQTLEVRNWLVERIVYMEHPVVC--SYPLEFRGRSWLQ 208
                           ::.||||.::|.| .|:...|.::........:.|  |...:|.|:..:|
Mouse   139 ---------------KIRLSHNPLHCEC-ALQEALWELKLDPDSVDEIACHTSAQEQFVGKPLIQ 187

  Fly   209 LKQD--EICKKEK-----------YQWFDTEENELMMGDQPAAVSAEREDEEELGKDFLPIVGNP 260
            :...  ..|...:           :.||     .:::.   ..|...|.::|:..:....:...|
Mouse   188 VLDSGASFCSTHRKTTDVAMLVTMFGWF-----TMVIA---YVVYYVRHNQEDARRHLEYLKSLP 244

  Fly   261 AATAKKVRSPQIPLP 275
            :|...|  .|..|:|
Mouse   245 SAPVSK--EPLSPVP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdpNP_001286712.1 LRR_RI <31..176 CDD:238064 41/154 (27%)
leucine-rich repeat 47..70 CDD:275378 5/22 (23%)
LRR_8 71..124 CDD:290566 20/61 (33%)
leucine-rich repeat 73..93 CDD:275378 5/23 (22%)
leucine-rich repeat 94..112 CDD:275378 8/22 (36%)
LRR_8 112..169 CDD:290566 14/57 (25%)
leucine-rich repeat 114..134 CDD:275378 6/19 (32%)
leucine-rich repeat 136..158 CDD:275378 2/21 (10%)
leucine-rich repeat 159..171 CDD:275378 4/11 (36%)
Lrrc3NP_660134.1 LRRNT 33..68 CDD:214470 11/44 (25%)
leucine-rich repeat 48..68 CDD:275378 6/25 (24%)
LRR 1 65..86 4/21 (19%)
LRR_8 69..125 CDD:290566 19/60 (32%)
LRR_4 69..105 CDD:289563 11/35 (31%)
leucine-rich repeat 69..89 CDD:275378 4/19 (21%)
LRR_4 88..129 CDD:289563 16/45 (36%)
LRR 2 89..110 7/20 (35%)
leucine-rich repeat 90..114 CDD:275378 8/23 (35%)
LRR 3 114..135 9/25 (36%)
leucine-rich repeat 115..138 CDD:275378 9/27 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24369
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.