DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wdp and lrrc4

DIOPT Version :10

Sequence 1:NP_611661.1 Gene:wdp / 37548 FlyBaseID:FBgn0034718 Length:677 Species:Drosophila melanogaster
Sequence 2:XP_002939414.1 Gene:lrrc4 / 100493671 XenbaseID:XB-GENE-968937 Length:641 Species:Xenopus tropicalis


Alignment Length:334 Identity:67/334 - (20%)
Similarity:106/334 - (31%) Gaps:143/334 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VHLTAW-----LALFLIVVANATPTPARTPTGCPADCTCS------------------------- 38
            ||.| |     .|::|:|....:......|..||:.|:||                         
 Frog     9 VHHT-WKAVLFSAIYLMVHMWISCAAYSGPQSCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTR 72

  Fly    39 -----------LSQHTHKPLYHLKC-----NSTRGLRLTEKTFQSTVPVHSIDLSHLNLTRL--- 84
                       :...|.:.|:||:.     ||.|.:.:  ..|.....:::::|....||.:   
 Frog    73 SLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEV--GAFNGLASLNTLELFDNWLTVIPSG 135

  Fly    85 ----------------------SHLLDKLPELTSADLSHNQLKDLGHLGKGLKR--LNLKHNQLT 125
                                  |:..:::|.|...||  .:||.|.::.:|...  .|||:..|.
 Frog   136 AFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDL--GELKKLEYISEGAFEGLYNLKYLNLG 198

  Fly   126 SDKLRKLP--------QHLQV-------------------------------------------- 138
            ...:|.:|        :.|::                                            
 Frog   199 MCNIRDMPNLTPLVGLEELEISGNNFPEIKPGSFHGLRSLKKLWIMNSQINTIERNAFDDLTSLV 263

  Fly   139 -LNLQHNNITHLPLEL-THMHQLHQLELSHNAINCSCQTLEVRNWLVERIVYMEHPV------VC 195
             |||.|||:|.||.:| ..:..|.:|.|.||..:|.|..|.:..||.|.|     |.      .|
 Frog   264 ELNLAHNNVTSLPHDLFAPLKYLVELHLHHNPWDCDCDVLWLSWWLREYI-----PTNSTCCGRC 323

  Fly   196 SYPLEFRGR 204
            ..|...||:
 Frog   324 HSPPHMRGK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdpNP_611661.1 leucine-rich repeat 47..70 CDD:275378 7/27 (26%)
LRR <72..>169 CDD:443914 34/177 (19%)
leucine-rich repeat 73..93 CDD:275378 4/44 (9%)
leucine-rich repeat 94..112 CDD:275378 6/17 (35%)
leucine-rich repeat 114..134 CDD:275378 6/29 (21%)
leucine-rich repeat 136..158 CDD:275378 11/67 (16%)
leucine-rich repeat 159..171 CDD:275378 5/11 (45%)
lrrc4XP_002939414.1 LRRNT 40..71 CDD:214470 5/30 (17%)
LRR <69..>295 CDD:443914 41/229 (18%)
leucine-rich repeat 71..94 CDD:275380 2/22 (9%)
leucine-rich repeat 95..118 CDD:275380 5/24 (21%)
leucine-rich repeat 119..142 CDD:275380 3/22 (14%)
leucine-rich repeat 143..166 CDD:275380 1/22 (5%)
leucine-rich repeat 167..191 CDD:275380 7/25 (28%)
leucine-rich repeat 192..213 CDD:275380 5/20 (25%)
leucine-rich repeat 214..237 CDD:275380 1/22 (5%)
leucine-rich repeat 238..261 CDD:275380 0/22 (0%)
leucine-rich repeat 262..283 CDD:275380 10/20 (50%)
LRRCT 294..345 CDD:214507 13/44 (30%)
IG_like 353..435 CDD:214653
Ig strand B 364..368 CDD:409353
Ig strand C 376..379 CDD:409353
Ig strand E 402..405 CDD:409353
Ig strand F 415..420 CDD:409353
Ig strand G 428..431 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.