DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5819 and PODNL1

DIOPT Version :9

Sequence 1:NP_001246458.1 Gene:CG5819 / 37547 FlyBaseID:FBgn0034717 Length:915 Species:Drosophila melanogaster
Sequence 2:XP_011526610.1 Gene:PODNL1 / 79883 HGNCID:26275 Length:579 Species:Homo sapiens


Alignment Length:526 Identity:142/526 - (26%)
Similarity:221/526 - (42%) Gaps:114/526 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CPWPCRCTWVVDSLYADCSRRSLQTYPNFDGIPVEHLDLSGNKFLEFPTLYAD---IDSLIYLDL 84
            ||..|.|. .||::  ||....|:.:|:......:||.|..|:..|.|  |.:   :..|..|:|
Human    44 CPLRCSCP-RVDTV--DCDGLDLRVFPDNITRAAQHLSLQNNQLQELP--YNELSRLSGLRTLNL 103

  Fly    85 SSNYISSIGA--KTLIGFTSLRTLLLANNSIDSWESLSPNE-----------------AFKYAPS 130
            .:|.|||.|.  :.....|.|:.|.:|:|.:.......|..                 .|...|:
Human   104 HNNLISSEGLPDEAFESLTQLQHLCVAHNKLSVAPQFLPRSLRVADLAANQVMEIFPLTFGEKPA 168

  Fly   131 LKRLGLDGNRLGSFG-NGESFELLTSSSLTDLGLSSCGISSIGGDQMVNQL--------PNLERL 186
            |:.:.|..|:|.:.| ..::|.  .|.::..|.||:            |||        |:||||
Human   169 LRSVYLHNNQLSNAGLPPDAFR--GSEAIATLSLSN------------NQLSYLPPSLPPSLERL 219

  Fly   187 NLANNQLAQI--AALPSRT-LRVLDLSNCSIKNLSGFFLDA-----MQNLEALNLSRN------- 236
            :|.||.::::  .||..:| ||.|.|.:..:.: ||  |||     :.:||.|:||.|       
Human   220 HLQNNLISKVPRGALSRQTQLRELYLQHNQLTD-SG--LDATTFSKLHSLEYLDLSHNQLTTVPA 281

  Fly   237 ---TELQFDSLSEDPI-------------LTYMLRKLDVSYCNLDSIELSGLPQ--------LTE 277
               ..|....|..:.|             |.|:|    :.:..|.|   ||||.        |..
Human   282 GLPRTLAILHLGRNRIRQVEAARLHGARGLRYLL----LQHNQLGS---SGLPAGALRPLRGLHT 339

  Fly   278 VRLQGNLLRVVDVNTFANNSMLEVVDLSQNVLRHIGQDAFAKLKRLKELNLAFNEI--ARLDRNF 340
            :.|.||.|..|..   |....|..:.|..|.:..:|.........|.|||||:|.:  ||:....
Human   340 LHLYGNGLDRVPP---ALPRRLRALVLPHNHVAALGARDLVATPGLTELNLAYNRLASARVHHRA 401

  Fly   341 IRNNDVLVELNLSRNVLQKLTKIVSNSVRTINMSWCEITSIESTALSSLSVIQKLDLSNN--LIT 403
            .|....|..|:|:.|.|.:|...:...:||:.:...::..:|...|:.|..:::|.|::|  .:.
Human   402 FRRLRALRSLDLAGNQLTRLPMGLPTGLRTLQLQRNQLRMLEPEPLAGLDQLRELSLAHNRLRVG 466

  Fly   404 DM--PTFMRSETLQQLNLANCRLTTVRNNTFREFPE-LADLHLNGNRLTSPIPPNYFDGNKFLDQ 465
            |:  .|:...:.||.|:|::..|:.|.    .:.|| |.:|||.|||: ..:.|..|.....|..
Human   467 DIGPGTWHELQALQMLDLSHNELSFVP----PDLPEALEELHLEGNRI-GHVGPEAFLSTPRLRA 526

  Fly   466 LWLGDN 471
            |:|..|
Human   527 LFLRAN 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5819NP_001246458.1 leucine-rich repeat 56..78 CDD:275380 7/24 (29%)
LRR_RI <58..236 CDD:238064 61/216 (28%)
LRR_8 78..141 CDD:290566 19/81 (23%)
leucine-rich repeat 79..102 CDD:275380 8/24 (33%)
leucine-rich repeat 103..130 CDD:275380 6/43 (14%)
leucine-rich repeat 131..155 CDD:275380 6/24 (25%)
LRR_8 156..214 CDD:290566 21/68 (31%)
leucine-rich repeat 158..182 CDD:275380 6/31 (19%)
LRR_8 202..285 CDD:290566 32/119 (27%)
leucine-rich repeat 204..227 CDD:275380 9/27 (33%)
leucine-rich repeat 254..274 CDD:275380 6/19 (32%)
LRR_8 273..333 CDD:290566 19/67 (28%)
leucine-rich repeat 275..298 CDD:275380 7/22 (32%)
LRR_RI 277..>471 CDD:238064 56/200 (28%)
leucine-rich repeat 299..322 CDD:275380 4/22 (18%)
LRR_8 321..402 CDD:290566 24/84 (29%)
leucine-rich repeat 323..346 CDD:275380 10/24 (42%)
leucine-rich repeat 347..391 CDD:275380 11/43 (26%)
leucine-rich repeat 392..413 CDD:275380 5/24 (21%)
LRR_8 393..448 CDD:290566 19/59 (32%)
leucine-rich repeat 414..437 CDD:275380 6/22 (27%)
LRRCT 471..517 CDD:214507 1/1 (100%)
PODNL1XP_011526610.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243556at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.