DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5819 and alrm

DIOPT Version :9

Sequence 1:NP_001246458.1 Gene:CG5819 / 37547 FlyBaseID:FBgn0034717 Length:915 Species:Drosophila melanogaster
Sequence 2:NP_651393.1 Gene:alrm / 43074 FlyBaseID:FBgn0039332 Length:471 Species:Drosophila melanogaster


Alignment Length:452 Identity:116/452 - (25%)
Similarity:182/452 - (40%) Gaps:99/452 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 SFELLTSSS----LTDLGLS---SCGISS---IGGDQMV--NQLP--NLERLNLANNQLAQIAAL 199
            |:.|.|.||    |..|.|.   |.||.:   ||....|  :|.|  ....|...|:.:|:|..|
  Fly    19 SYHLATPSSGSGQLRRLWLQDHCSAGICTNVVIGRSDYVILSQAPIGGTTMLTFLNSSIAKIPHL 83

  Fly   200 PSRT---LRVLDLSNCSIKNLSGFFLDAMQNLEALNLSRNTELQFDSLSEDPILTYMLRKLDVSY 261
            ...|   |:||.:.|||::.......:...||.:|.|.      ::.|.:.|...::        
  Fly    84 LFDTFPDLQVLRMENCSLETFEKPQFEGASNLMSLFLG------YNRLKDIPKNIFL-------- 134

  Fly   262 CNLDSIELSGLPQLTEVRLQGNLLRVVDVNTFANNSMLEVVDLS--QNVLRHIGQDAFAKLKRLK 324
                     |...|..:.||||.|:.:..::|  :::.||.:||  :|.|..|....|:.:::|.
  Fly   135 ---------GADNLATLHLQGNQLKQLGNHSF--HALKEVKELSLAENQLEQISLGVFSGMRKLM 188

  Fly   325 ELNLAFNEIARLDRNFIRNNDVLVELNLSRN-------VLQKLTKI-----VSNSV---RTINMS 374
            :||||.|.:..|.|.....|..|.:|||:||       .|.||..:     :|.::   .|:|.:
  Fly   189 DLNLAGNRLDALPRGVFDRNLNLTKLNLARNRFTAFESELLKLQPVFTQLDISGNIFQELTLNFT 253

  Fly   375 WCEITSIESTALSSLS---VIQKLDLSNNLITDMPTFMRSETLQQLNLANCRLTTVRNNTFREFP 436
            ..::....|..|..|:   ||.:|||.||.:.:||....:..:..|:|::..|..::.|..|.|.
  Fly   254 MLDVAIAHSCDLRRLTVYGVIHELDLHNNSLREMPHIPLAANVSSLDLSHNPLGNLQGNPLRRFT 318

  Fly   437 ELADLHL------------------------NGNRLTSPIPPNYFDGNKFLDQLWLGDNPWICDC 477
            .|..|:|                        :||.:.| :....||..|.|...:...|.|.|  
  Fly   319 SLLRLNLSATGAHELPEGLFKKQSHLQMLDISGNSIYS-LKITIFDSLKALQYFYFQQNNWNC-- 380

  Fly   478 HSPLFVDFYDYLTAKPAKIKDRNHLR-CAAPAVFYGKLWEFACADVWILNARTSSTGEKAWS 538
                  ||...|.:...|.||.:.:. ..||.:....:...||   |..:.:.|...|...|
  Fly   381 ------DFLQLLMSSFVKRKDISFMEDITAPELVDDYVDGIAC---WYESDKQSKKCESGGS 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5819NP_001246458.1 leucine-rich repeat 56..78 CDD:275380
LRR_RI <58..236 CDD:238064 32/103 (31%)
LRR_8 78..141 CDD:290566
leucine-rich repeat 79..102 CDD:275380
leucine-rich repeat 103..130 CDD:275380
leucine-rich repeat 131..155 CDD:275380 2/5 (40%)
LRR_8 156..214 CDD:290566 24/74 (32%)
leucine-rich repeat 158..182 CDD:275380 11/33 (33%)
LRR_8 202..285 CDD:290566 19/85 (22%)
leucine-rich repeat 204..227 CDD:275380 6/22 (27%)
leucine-rich repeat 254..274 CDD:275380 1/19 (5%)
LRR_8 273..333 CDD:290566 21/61 (34%)
leucine-rich repeat 275..298 CDD:275380 7/22 (32%)
LRR_RI 277..>471 CDD:238064 63/237 (27%)
leucine-rich repeat 299..322 CDD:275380 8/24 (33%)
LRR_8 321..402 CDD:290566 31/98 (32%)
leucine-rich repeat 323..346 CDD:275380 9/22 (41%)
leucine-rich repeat 347..391 CDD:275380 15/61 (25%)
leucine-rich repeat 392..413 CDD:275380 8/20 (40%)
LRR_8 393..448 CDD:290566 18/78 (23%)
leucine-rich repeat 414..437 CDD:275380 6/22 (27%)
LRRCT 471..517 CDD:214507 11/46 (24%)
alrmNP_651393.1 LRR_RI 84..354 CDD:238064 73/294 (25%)
LRR_8 91..149 CDD:290566 18/80 (23%)
leucine-rich repeat 91..114 CDD:275380 6/22 (27%)
leucine-rich repeat 115..138 CDD:275380 6/45 (13%)
LRR_8 138..197 CDD:290566 21/60 (35%)
leucine-rich repeat 139..162 CDD:275380 7/24 (29%)
leucine-rich repeat 163..186 CDD:275380 7/22 (32%)
LRR_8 185..243 CDD:290566 19/57 (33%)
leucine-rich repeat 187..210 CDD:275380 9/22 (41%)
leucine-rich repeat 211..283 CDD:275380 21/71 (30%)
leucine-rich repeat 284..319 CDD:275380 8/34 (24%)
LRR_8 318..377 CDD:290566 10/59 (17%)
leucine-rich repeat 320..343 CDD:275380 3/22 (14%)
leucine-rich repeat 344..365 CDD:275380 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.