DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5819 and CG6749

DIOPT Version :10

Sequence 1:NP_611660.1 Gene:CG5819 / 37547 FlyBaseID:FBgn0034717 Length:915 Species:Drosophila melanogaster
Sequence 2:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster


Alignment Length:347 Identity:100/347 - (28%)
Similarity:158/347 - (45%) Gaps:35/347 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 GNGESFELLTSSSLTDLGLSSCGISSIGGDQMVNQLPNLERLNLANNQLAQIAA---LPSRTLRV 206
            |:||:.:.|  ::|.||.|:.....::..:.. :.||||.:|||:...|..|..   .|...|:.
  Fly    71 GSGENADHL--ANLLDLDLTGAAPINVHTNGF-SILPNLRQLNLSGCGLVDIRGNHFAPESALQR 132

  Fly   207 LDLSNCSIKNLSGFFLDAMQNLEALNLSRNTELQFDSLSEDPILTYMLRKLDVSYCNLDSIELSG 271
            :|.|:..::.|...|...::.|...|.|.|...|.| |...|    :|.:|::.:..|.:.....
  Fly   133 IDFSHNQMELLDRDFFGNLRKLIYANFSHNALKQCD-LPHMP----LLNRLELGHNRLVNATFGV 192

  Fly   272 LPQLTEVRLQGNLLRVVDVNTFANNSMLEVVDLSQNVLRHIGQDAFAKLKRLKELNLAFNEIARL 336
            .|||.|:.|..|.|..:|||.|.....|..:.||.|.|..||.:.|..|.:|::|||:.|.:..|
  Fly   193 CPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDAL 257

  Fly   337 D-------RNFIRNNDVLVELNLSRNVLQKLTKIVSNSVRT------INMSWCEITSIESTALSS 388
            .       :||:.:   |.:|:||.|   ::..:..|..|.      :::|...|.|:.......
  Fly   258 RPNVFGAVQNFVLH---LQQLDLSGN---RIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVG 316

  Fly   389 LSVIQKLDLSNNLITDM--PTFMRSETLQQLNLANCRLTTVRNNTF--REFPELADLHLNGNRLT 449
            |..::||.|..|.|.::  .||.....|..|:|:...|..:....|  ...|.:..|:|||||: 
  Fly   317 LGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRM- 380

  Fly   450 SPIPPNYFDGNKFLDQLWLGDN 471
            ..:.|..|....||:.|.||.|
  Fly   381 KHLHPLAFSSLPFLEYLKLGHN 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5819NP_611660.1 RNA1 <56..193 CDD:444072 15/47 (32%)
leucine-rich repeat 56..78 CDD:275380
leucine-rich repeat 79..102 CDD:275380
leucine-rich repeat 103..130 CDD:275380
leucine-rich repeat 131..155 CDD:275380 4/9 (44%)
LRR 134..>466 CDD:443914 96/340 (28%)
leucine-rich repeat 158..182 CDD:275380 5/23 (22%)
leucine-rich repeat 204..227 CDD:275380 5/22 (23%)
leucine-rich repeat 254..274 CDD:275380 3/19 (16%)
leucine-rich repeat 275..298 CDD:275380 9/22 (41%)
leucine-rich repeat 299..322 CDD:275380 9/22 (41%)
leucine-rich repeat 323..346 CDD:275380 8/29 (28%)
leucine-rich repeat 347..391 CDD:275380 11/49 (22%)
leucine-rich repeat 392..413 CDD:275380 7/22 (32%)
leucine-rich repeat 414..437 CDD:275380 5/24 (21%)
LRRCT 471..517 CDD:214507 1/1 (100%)
CG6749NP_648354.1 LRR_8 104..164 CDD:404697 18/59 (31%)
leucine-rich repeat 106..129 CDD:275380 7/22 (32%)
leucine-rich repeat 130..153 CDD:275380 5/22 (23%)
leucine-rich repeat 154..195 CDD:275380 11/45 (24%)
leucine-rich repeat 196..219 CDD:275380 9/22 (41%)
LRR 199..>452 CDD:443914 62/211 (29%)
leucine-rich repeat 220..243 CDD:275380 9/22 (41%)
leucine-rich repeat 244..267 CDD:275380 6/22 (27%)
leucine-rich repeat 272..295 CDD:275380 7/25 (28%)
leucine-rich repeat 296..319 CDD:275380 4/22 (18%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
leucine-rich repeat 344..369 CDD:275380 5/24 (21%)
leucine-rich repeat 370..393 CDD:275380 8/23 (35%)
leucine-rich repeat 394..417 CDD:275380 5/9 (56%)
leucine-rich repeat 418..441 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.