DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5819 and Lrrc15

DIOPT Version :9

Sequence 1:NP_001246458.1 Gene:CG5819 / 37547 FlyBaseID:FBgn0034717 Length:915 Species:Drosophila melanogaster
Sequence 2:NP_659551.1 Gene:Lrrc15 / 246296 RGDID:70551 Length:578 Species:Rattus norvegicus


Alignment Length:538 Identity:139/538 - (25%)
Similarity:213/538 - (39%) Gaps:116/538 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVLGVISSCRA-------VNCPWPCRCTWVVDSLYADCSRRSLQTYPNFDGIPVEHLDLS--GN 64
            ||::|    |:|       ..||..|.|:   .:...:|:...:...|.  .:|...:.|.  ..
  Rat     8 LLLVG----CQAWALGLAYYGCPSECTCS---RASQVECTGARIVAMPT--PLPWNAMSLQVVNT 63

  Fly    65 KFLEFP-TLYADIDSLIYLDLSSNYISSI--GAKTLIGFTSLRTLLLANNSIDSWESLSPNEAFK 126
            ...|.| .|:.:|.:||.|.:..|.:|:|  ||...:|  |||.|.||||.:    .:.|...| 
  Rat    64 HITELPENLFLNISALIALKMEKNELSTIMPGAFRNLG--SLRYLSLANNKL----RMLPIRVF- 121

  Fly   127 YAPSLKRLGLDGNRLGSFGNGESFELLTSSSLTDLGLSSCGISSIGGDQMVNQLPNLERLNLANN 191
                                                            |.||   |||.|.|:||
  Rat   122 ------------------------------------------------QDVN---NLESLLLSNN 135

  Fly   192 QLAQIAALPSR-----TLRVLDLSNCSIKNLSGFFLDAMQNLEALNLSRNTELQFDSLSEDPILT 251
            ||.||.  |::     .||.|.|...:::::.....|.:..|..|||.||:   |..||  |.|.
  Rat   136 QLVQIQ--PAQFSQFSNLRELQLHGNNLESIPEEAFDHLVGLTKLNLGRNS---FTHLS--PRLF 193

  Fly   252 YMLRKLDVSYCNLDSIELSGLP--------QLTEVRLQGNLLRVVDVNTFANNSMLEVVDLSQNV 308
            ..|..|.|  ..|....||.:|        .|.|:.||.|.:..:....|.||..|:.:.||.|.
  Rat   194 QHLGNLQV--LRLHENRLSDIPMGTFDALGNLQELALQENQIGTLSPGLFHNNRNLQRLYLSNNH 256

  Fly   309 LRHIGQDAFAKLKRLKELNLAFNEIARLDRNFIRNNDVLVELNLSRNVLQKLTKIVSNSVRTIN- 372
            :..:....|.:|.:|.:|.|..|.:..|..........|.||.|..|   .:|.:..|:...:| 
  Rat   257 ISQLPPGIFMQLPQLNKLTLFGNSLRELSPGVFGPMPNLRELWLYNN---HITSLADNTFSHLNQ 318

  Fly   373 -----MSWCEITSIESTALSSLSVIQKLDLSNNLITDMPT--FMRSETLQQLNLANCRLTTVRNN 430
                 :|..::|.|...|.:.|:.:::|.|..|.:.|:.:  |.....||.::|.:.||..:..:
  Rat   319 LQVLILSHNQLTYISPGAFNGLTNLRELSLHTNALQDLDSNVFRSLANLQNISLQSNRLRQLPGS 383

  Fly   431 TFREFPELADLHLNGNRLTSPIPPNYFDGNKFLDQLWLGDNPWICDCHSPLFVDFYDYLTAKPAK 495
            .|.....|..:.|..|.|.: :|...||....|.:|.|.||||.||..   .:..:::|....|:
  Rat   384 IFANVNGLTTIQLQNNNLEN-LPLGIFDHLVNLCELRLYDNPWRCDSD---ILPLHNWLLLNRAR 444

  Fly   496 IKDRNHLRCAAPAVFYGK 513
            :.......|::||...|:
  Rat   445 LGTDTLPVCSSPANVRGQ 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5819NP_001246458.1 leucine-rich repeat 56..78 CDD:275380 5/24 (21%)
LRR_RI <58..236 CDD:238064 48/187 (26%)
LRR_8 78..141 CDD:290566 19/64 (30%)
leucine-rich repeat 79..102 CDD:275380 9/24 (38%)
leucine-rich repeat 103..130 CDD:275380 9/26 (35%)
leucine-rich repeat 131..155 CDD:275380 0/23 (0%)
LRR_8 156..214 CDD:290566 19/62 (31%)
leucine-rich repeat 158..182 CDD:275380 3/23 (13%)
LRR_8 202..285 CDD:290566 28/95 (29%)
leucine-rich repeat 204..227 CDD:275380 5/22 (23%)
leucine-rich repeat 254..274 CDD:275380 7/27 (26%)
LRR_8 273..333 CDD:290566 19/67 (28%)
leucine-rich repeat 275..298 CDD:275380 8/22 (36%)
LRR_RI 277..>471 CDD:238064 52/201 (26%)
leucine-rich repeat 299..322 CDD:275380 6/22 (27%)
LRR_8 321..402 CDD:290566 21/86 (24%)
leucine-rich repeat 323..346 CDD:275380 5/22 (23%)
leucine-rich repeat 347..391 CDD:275380 13/49 (27%)
leucine-rich repeat 392..413 CDD:275380 5/22 (23%)
LRR_8 393..448 CDD:290566 14/56 (25%)
leucine-rich repeat 414..437 CDD:275380 6/22 (27%)
LRRCT 471..517 CDD:214507 11/43 (26%)
Lrrc15NP_659551.1 LRR_8 54..113 CDD:290566 22/60 (37%)
LRR 1 54..75 4/20 (20%)
LRR 2 78..99 8/20 (40%)
leucine-rich repeat 79..102 CDD:275380 9/24 (38%)
LRR_RI <94..303 CDD:238064 74/275 (27%)
LRR_8 102..161 CDD:290566 29/116 (25%)
LRR 3 102..123 10/73 (14%)
leucine-rich repeat 103..126 CDD:275380 12/78 (15%)
LRR 4 126..147 12/22 (55%)
leucine-rich repeat 127..150 CDD:275380 11/24 (46%)
LRR_8 149..209 CDD:290566 20/66 (30%)
LRR 5 150..171 4/20 (20%)
leucine-rich repeat 151..174 CDD:275380 5/22 (23%)
LRR 6 174..195 11/25 (44%)
leucine-rich repeat 175..198 CDD:275380 12/27 (44%)
LRR_8 198..257 CDD:290566 18/60 (30%)
LRR 7 198..219 6/22 (27%)
leucine-rich repeat 199..222 CDD:275380 6/24 (25%)
LRR 8 222..243 6/20 (30%)
leucine-rich repeat 223..246 CDD:275380 8/22 (36%)
LRR_8 245..305 CDD:290566 16/62 (26%)
LRR 9 246..267 5/20 (25%)
leucine-rich repeat 247..270 CDD:275380 6/22 (27%)
LRR 10 270..291 5/20 (25%)
leucine-rich repeat 271..294 CDD:275380 5/22 (23%)
LRR_8 293..353 CDD:290566 16/62 (26%)
LRR 11 294..315 7/23 (30%)
leucine-rich repeat 295..318 CDD:275380 7/25 (28%)
LRR_4 318..358 CDD:289563 9/39 (23%)
LRR 12 318..339 4/20 (20%)
leucine-rich repeat 319..342 CDD:275380 5/22 (23%)
LRR 13 342..363 5/20 (25%)
leucine-rich repeat 343..364 CDD:275380 5/20 (25%)
LRR_8 366..424 CDD:290566 17/58 (29%)
LRR 14 366..387 6/20 (30%)
leucine-rich repeat 367..387 CDD:275380 6/19 (32%)
LRR 15 390..411 6/21 (29%)
leucine-rich repeat 391..412 CDD:275380 7/21 (33%)
TPKR_C2 423..>462 CDD:301599 10/41 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..500
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5989
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.