DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oatp58Db and AT5G65687

DIOPT Version :9

Sequence 1:NP_611658.3 Gene:Oatp58Db / 37544 FlyBaseID:FBgn0034715 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_680469.1 Gene:AT5G65687 / 836697 AraportID:AT5G65687 Length:492 Species:Arabidopsis thaliana


Alignment Length:664 Identity:125/664 - (18%)
Similarity:216/664 - (32%) Gaps:239/664 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QRFATAHMFVIVYGIASCFLAMAFTYFTGTITTMEKRFNIPTKI---SGLITVGNDISTVFSSAF 107
            :||.|...||.:.    |.:.:......|.|.:  ...|..:|:   .|:.:.|..|...|:   
plant    21 KRFLTPGRFVTIL----CIINLINYVDRGVIAS--NGVNGSSKVCDAKGVCSAGTGIQGEFN--- 76

  Fly   108 LSYYASRGHRPRWVALGLIIIAIFCLLMLTPHIFYGPGEEALRLTEEYGMSESFGASLNITEKND 172
            |:.:..          ||:..|....|::...||.|       |::.:...:..|..|.:     
plant    77 LTNFED----------GLLSSAFMVGLLVASPIFAG-------LSKRFNPFKLIGVGLTV----- 119

  Fly   173 SLCHEKNSNCLERAGDYTPIVL--------FFIAQF--IGGIGCSLFYAPGLSYMDDNSASSKTP 227
                            :|..|:        :.||.|  ..|:|.:.|.:....|:||::..::..
plant   120 ----------------WTIAVIGCGFSYNFWMIAVFRMFVGVGEASFISLAAPYIDDSAPVARKN 168

  Fly   228 AMLSWSSFLRMLGPAMGFSMVSLCLRLYIDPFKKPLITTNDPRWMGAWWIG------WILLTFIL 286
            ..|.........|.|:|:....     ||.         |...|..|::|.      :::|:|.:
plant   169 FWLGLFYMCIPAGVALGYVFGG-----YIG---------NHLGWRWAFYIEAIAMAVFVILSFCI 219

  Fly   287 TISAVFVGMFPKEMPR------------AKARRLKADGEED---IPLAGRSFQDMLDSLKRLASN 336
            .......|...|:..:            |:|.::|....:.   :.|.|:       .||.|.|.
plant   220 KPPQQLKGFADKDSKKPSTSIETVAPTDAEASQIKTKTPKSKNLVVLFGK-------DLKALFSE 277

  Fly   337 KVYVYNMLASILYLF--GYMPYWIFTPKYIEIQYRQSASTSTMATGTWALGFSAAGILISGYVIS 399
            ||::.|:|..|.|.|  |...||  .||                               :|:.|.
plant   278 KVFIVNVLGYITYNFVIGAYSYW--GPK-------------------------------AGFGIY 309

  Fly   400 KYKPSARAMAAWNFVVDYL-TVAGMLCYVLVGCDESDRANSLSIVPTGDSCSASCVCEYVYYAPV 463
            |.|.:.........:...: |:.|  .|||      ||.|: ::..|....:||.:         
plant   310 KMKNADMIFGGLTIICGIIGTLGG--SYVL------DRINA-TLSNTFKLLAASTL--------- 356

  Fly   464 CSPENITFISACHAGCTDKAINELGKTIYTGCRCMGNVSSIISLSNVTSLASQSQIAMDGACPVD 528
                                   ||.........|.|:.:.|:|..|                  
plant   357 -----------------------LGAAFCFTAFLMKNMYAFIALFAV------------------ 380

  Fly   529 CNKQFLIFLAVMCFLKFVGATGRSSNLLLALRCVPSKDKTFSLGFGSMVYSVLAFIPSPIVFGWM 593
              .:.||| |....:.||           .|.||....:..|:...:::..:|..:||..::|.|
plant   381 --GEILIF-APQAPVNFV-----------CLHCVRPNLRPLSMASSTVLIHILGDVPSSPLYGKM 431

  Fly   594 LDSYCLVWGKTCSSKGNCWIYDTKSLRYTMNLVCASLIFLGS-FWNIGVWYHAKDM--KVFDEDE 655
            .| :...|.|:                   .|:..|::||.: .|.||::.::.|.  :|.::||
plant   432 QD-HLKNWRKS-------------------TLIITSILFLAAIIWGIGIFMNSVDRSNEVSEDDE 476

  Fly   656 KTVQAKQSDDIELK 669
                 .:.|.:|.|
plant   477 -----VEEDKLESK 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Oatp58DbNP_611658.3 OATP 53..619 CDD:281175 108/602 (18%)
MFS 55..>410 CDD:119392 71/390 (18%)
KAZAL_SLC21 447..499 CDD:238650 4/51 (8%)
AT5G65687NP_680469.1 MFS 30..458 CDD:119392 112/621 (18%)
MFS_1 71..418 CDD:284993 91/514 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.