DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oatp58Da and slco2a1

DIOPT Version :9

Sequence 1:NP_611657.2 Gene:Oatp58Da / 37543 FlyBaseID:FBgn0050277 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_001083051.1 Gene:slco2a1 / 100038802 ZFINID:ZDB-GENE-060606-3 Length:221 Species:Danio rerio


Alignment Length:257 Identity:60/257 - (23%)
Similarity:98/257 - (38%) Gaps:71/257 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KGPSMQRFATEHMYVILYGLAGCVMTMTFAYFNGTITTLEKRYKIPTKVSGIISVGNDISTMLTA 119
            |.|....|....::|:.:||......:..:||..||||:|:||.:.:..||.||..:::...:..
Zfish     9 KKPKPSLFCNIKIFVLCHGLLQLTQLLYSSYFKSTITTIERRYGLDSLSSGTISSLHEVGNTVLK 73

  Fly   120 AILGYYAGHRHRPRWMGIGLLTIVAFCLLTSSLHFL-----YGAGEDALQLTRE---FGQVNET- 175
            |.:.|.....||||::|:|.|.:....::.:..|||     |   :..|..:|:   :.:.|.| 
Zfish    74 AFVSYLGSRVHRPRFIGLGGLLMSISAMILALPHFLSQPYTY---DSVLHASRQDMCYLRANVTG 135

  Fly   176 --LTNQERDKKLCQPTAGGCVQEEVGLWVPQVFLFAAQLISGVGQALFYTLGIAYMDDNTSKAKT 238
              ...||..:||...:.         .|   |.:..||.:|.|                      
Zfish   136 AEACGQEDSRKLMDTSK---------FW---VLMATAQYLSSV---------------------- 166

  Fly   239 PAMLSMSTFLRMLGPAIGYSLAAVCLRL-----YIEPTLEPLIGQEDPRW-------LGAWW 288
              .||::|:|.:.|...||   ..|.|.     |:      ......|.|       |.:|:
Zfish   167 --TLSINTWLEVQGIHSGY---VSCCRQNTCFEYL------FTSAHQPTWTDSGTFHLHSWY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Oatp58DaNP_611657.2 OATP 67..626 CDD:281175 57/245 (23%)
MFS 69..>425 CDD:119392 57/243 (23%)
KAZAL_SLC21 462..514 CDD:238650
slco2a1NP_001083051.1 OATP 21..>110 CDD:281175 27/88 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.