DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and CUL7

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_016867022.1 Gene:CUL7 / 9820 HGNCID:21024 Length:1795 Species:Homo sapiens


Alignment Length:124 Identity:31/124 - (25%)
Similarity:53/124 - (42%) Gaps:26/124 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 REALKKYLHYYERWENHSKSLKLEQQTIDRLRQRINSKVMNGSGTWIDWQYL-FNAAALLAKCRY 436
            |..|.:|.::|.:.::|.   .||:.:..||:           .||:.|..| |....|...   
Human  1512 RGTLNRYSNFYNKSQSHP---ALERGSQRRLQ-----------WTWLGWAELQFGNQTLHVS--- 1559

  Fly   437 TLQ-YTYPYAYYMEAGSRKNLFEYQQAQLEAEIENLSWKIERAETTDLG--DLENQMDI 492
            |:| :...|...::|.|.::|..:  :.|.|::.|   :.....|:..|  ||..|.||
Human  1560 TVQMWLLLYLNDLKAVSVESLLAF--SGLSADMLN---QAIGPLTSSRGPLDLHEQKDI 1613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687
IBR 222..284 CDD:214763
CUL7XP_016867022.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.