DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and ARI14

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_201178.1 Gene:ARI14 / 836493 AraportID:AT5G63730 Length:506 Species:Arabidopsis thaliana


Alignment Length:471 Identity:105/471 - (22%)
Similarity:183/471 - (38%) Gaps:92/471 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YECLTVEDIEKLLNERVEKLNTILQITPSLAKVLLLEHQWNNVAVVEKYRQDANALLVTARIKPP 111
            |..||..:|...:.:::.:::.|..|:.|.|.|||:..:|:::.|.|:..::...||:.:.:|  
plant     9 YSVLTRNEITVKMKKQINEISDIFFISNSDATVLLMYLRWDSLRVSERLGENKEKLLMDSGLK-- 71

  Fly   112 SVAVTDTASTSAAAASAQLLRLGSSGYKTTASATPQYRSQMCPVCASSQLGDK-FYSLA-CGHSF 174
            ||.: |.:..|::..|.:               |..|...          ||. ..|:. |.|.|
plant    72 SVMI-DPSPDSSSEISLE---------------TDVYEFD----------GDNDLISMPFCSHKF 110

  Fly   175 CKDCWTIYFETQIF--QGISTQIGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHP 237
            ....|..|.|...:  :.|.|.|.|..|.|...|..|.:..|..|.  ::.|:::.::.|::.:.
plant   111 DSKYWREYLEKNFYYVEKIQTTISCPDQDCRSAVGPDTIEKLTVRD--QEMYERYIWRSYIEGNK 173

  Fly   238 EL--RFCPGPNCQIIV---QSSEISAKRAICKACHTG--FCFRCGMDYHAPTDCQVIKKWL---- 291
            .|  :.||..||..::   |.::...:.::...|..|  ||:||.::.|.|..|.....||    
plant   174 VLMIKQCPARNCDYVIEFHQENDDDDEYSLNVVCICGHIFCWRCRLESHRPVSCNKASDWLCSAT 238

  Fly   292 TKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQCFNCKHDFCWMCLGDWKTHGSEYYE--- 353
            .|.:|:|.:.......|..||.|...:|.:..........|:..||..||...:.|..|..:   
plant   239 MKISDESFSLYPTKTKTVTCPHCLCSLESDTKMPQFLTCVCRLRFCSRCLRSEEAHKIEAVDSGF 303

  Fly   354 CSR------YKDNPNIANESVHVQAREALKKYLHYYERWENHSKSLKLEQQTIDRLRQRINSKVM 412
            |.:      .:|..|:..:.:     |..|..|..:|.......|..|.:|.|..:|:.:     
plant   304 CIKTEVGILCEDRWNVCQKLL-----EQAKSDLEAFEETNIKKPSDLLREQDIMIIREGL----- 358

  Fly   413 NGSGTWIDWQYLFNAAALLAKCRYTLQYTYPYAYY-MEAGSRKNLFEYQQAQLEAEIENLSWKIE 476
                            .|:.:||..|::...|.|: .|..:.|....|.|....|.:::.|    
plant   359 ----------------MLIVQCRRVLKWCCVYDYFHTEYENSKEYLRYLQGNAIATLQSYS---- 403

  Fly   477 RAETTDLGDLENQMDI 492
                   ..|:.|.||
plant   404 -------NTLQEQKDI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 15/56 (27%)
IBR 222..284 CDD:214763 16/68 (24%)
ARI14NP_201178.1 IBR 158..227 CDD:214763 16/68 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3648
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.