DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and AT3G53690

DIOPT Version :10

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_190937.1 Gene:AT3G53690 / 824536 AraportID:AT3G53690 Length:320 Species:Arabidopsis thaliana


Alignment Length:229 Identity:62/229 - (27%)
Similarity:95/229 - (41%) Gaps:17/229 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GSSGYKTTASATPQYRSQMCPVCASSQ-LGDKFYSLACGHSFCKDCWTIYFETQIFQGISTQIGC 197
            |.|....||:..       |.:|..|: :.:.|....|.|.:|.||.:.|...::...| ..|.|
plant   103 GQSSSSKTATFD-------CEICVDSKSIIESFRIGGCSHFYCNDCVSKYIAAKLQDNI-LSIEC 159

  Fly   198 MAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNCQIIV--QSSEISAKR 260
            ....|:.|:..|....::.:.|. |::.. |..:.|....:..:||..:|..:|  :.||:..|.
plant   160 PVSGCSGRLEPDQCRQILPKEVF-DRWGD-ALCEAVVMRSKKFYCPYKDCSALVFLEESEVKMKD 222

  Fly   261 AICKACHTGFCFRCGMDYHAPTDCQVIKKWLT--KCADDSETANYISAHT-KDCPKCHICIEKNG 322
            :.|..||...|..||..:|....|:..:|...  :..||...|....... |.||.|...|||:.
plant   223 SECPHCHRMVCVECGTQWHPEMTCEEFQKLAANERGRDDILLATMAKQKKWKRCPSCKFYIEKSQ 287

  Fly   323 GCNHMQCFNCKHDFCWMCLGDWKTHGSEYYECSR 356
            ||.:|:| .|...||:.|....:.|....|.|.|
plant   288 GCLYMKC-RCGLAFCYNCGTPSRDHTHYCYNCKR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 152..204 CDD:438429 14/52 (27%)
BRcat_RBR_TRIAD1 231..302 CDD:439005 19/74 (26%)
Rcat_RBR_TRIAD1 306..361 CDD:439021 19/52 (37%)
Ariadne 371..>477 CDD:466073
AT3G53690NP_190937.1 RING_Ubox 110..165 CDD:473075 15/62 (24%)
BRcat_RBR_unk 197..249 CDD:439033 15/51 (29%)
Rcat_RBR_unk 272..307 CDD:439035 15/35 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.