DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and AT3G45470

DIOPT Version :10

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_190133.1 Gene:AT3G45470 / 823687 AraportID:AT3G45470 Length:222 Species:Arabidopsis thaliana


Alignment Length:210 Identity:54/210 - (25%)
Similarity:87/210 - (41%) Gaps:24/210 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 RSQMCPVCASSQLGDKFYSL-ACGHSFCKDCWTIYFETQIFQGISTQIGCMAQMCNVRVPEDLVL 212
            :.:.|.:|......|:.:.: .|.|..|..|.....|.::..|  |...|:...|.::      |
plant     2 KGETCVICLEETKADRMFVMDKCLHRHCYPCVNQLVEVKLRNG--TVPTCLDYECKLK------L 58

  Fly   213 TL-----VTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNCQIIVQSSEISAK-----RAICKACH 267
            :|     |.:|.:.:.::....::.:.....: :||..||..::..:|||..     || |..|.
plant    59 SLENCFKVLKPKVIELWKHMMKEESIPLAKRI-YCPYINCSTLMSKTEISRSNKSNDRA-CIKCS 121

  Fly   268 TGFCFRCGMDYHAPTDCQVIKKWLTKCADDSETANYISAHTK--DCPKCHICIEKNGGCNHMQCF 330
            ...|..|.:.:|:...|...||.......|..|...::...|  .|.||...||.|.|||||.| 
plant   122 GLVCIDCKVPWHSDLSCAEYKKLHPDPVLDDLTLKLLANDQKWRQCVKCRHLIELNQGCNHMTC- 185

  Fly   331 NCKHDFCWMCLGDWK 345
            .|.:.||:.|..:||
plant   186 RCGYQFCYKCGVEWK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 152..204 CDD:438429 12/52 (23%)
BRcat_RBR_TRIAD1 231..302 CDD:439005 19/75 (25%)
Rcat_RBR_TRIAD1 306..361 CDD:439021 19/42 (45%)
Ariadne 371..>477 CDD:466073
AT3G45470NP_190133.1 BRcat_RBR_unk 87..141 CDD:439033 15/55 (27%)
Rcat_RBR_unk 163..199 CDD:439035 17/36 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.