DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and Cul9

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_011245024.1 Gene:Cul9 / 78309 MGIID:1925559 Length:2580 Species:Mus musculus


Alignment Length:448 Identity:112/448 - (25%)
Similarity:175/448 - (39%) Gaps:73/448 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LTVEDIEKLLNERVEKLNTILQITPSLAKVLLLEHQWNNVAVVEKYRQDANALLVTARIKPPSVA 114
            ::.:::|.|:.:.|.::...|.:.|.:|:.||....|....:::.|..|...||:.|.::.|...
Mouse  2043 MSPQEVEGLMEQTVRQVQETLNLEPDVAQHLLAHSHWGTEQLLQSYSDDPEPLLLAAGLRVPQAQ 2107

  Fly   115 VTDTASTSAAAASAQLLRLGSSGYKTTASATPQYRSQMCPVCASSQLG--DKFYSLACGHSFCKD 177
            |..|                              |...||||. :.||  |...||.|.|..||.
Mouse  2108 VVPT------------------------------RPDQCPVCV-TPLGPHDDSPSLCCLHCCCKS 2141

  Fly   178 CWTIYFETQIFQGISTQIGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFC 242
            ||..|..|:|.|.......|....|..:.....:..:|:.|.:..||::...:.||:|...|.:|
Mouse  2142 CWNEYLTTRIEQNFVLNCTCPIADCPAQPTGAFIRNIVSSPEVISKYEKALLRGYVESCSNLTWC 2206

  Fly   243 PGP-NCQIIVQSSEISAKRAICKACHTGFCFRCGM-DYHAPTDCQVIKKWLTKCADD-------- 297
            ..| .|..|:....:.: ...|..|....||.|.. :.|.|..|..:.:|:    ||        
Mouse  2207 TNPQGCDRILCRQGLGS-GTTCSKCGWASCFSCSFPEAHYPASCGHMSQWV----DDGGYYDGMS 2266

  Fly   298 --SETANYISAHTKDCPKCHICIEKNGGCNHMQCFNCKHDFCWMCLGDWKTHGSEYYECSRYKDN 360
              :::.:.....:|.||.|...||||.||.||.|..|.|.|||.||..||....:||.||..:|.
Mouse  2267 VEAQSKHLAKLISKRCPSCQAPIEKNEGCLHMTCARCNHGFCWRCLKSWKPSHKDYYNCSAMEDC 2331

  Fly   361 PNIANESVHVQAREALKKYLHYYERWENHSKSLKLEQQTIDRLRQRINS-------KVMNGSGTW 418
            ..:..|......|....:.:|.:       .|:.|.|:....||.:.::       |        
Mouse  2332 MKVLGEVERGLLRSPAYQNVHSH-------LSMCLHQEFAVNLRNQASAIQEVPPPK-------- 2381

  Fly   419 IDWQYLFNAAALLAKCRYTLQYTYPYAYYMEAGSRKNLFEYQQAQLEAEIENLSWKIE 476
             .:.:|.:|...|.:.|..|.|...|::|.:.....::.|.|...||.....|...:|
Mouse  2382 -SFTFLQDACRALEQARKVLAYACVYSFYSQDTEYMDVVEQQTENLELHTNALQILLE 2438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 21/54 (39%)
IBR 222..284 CDD:214763 17/63 (27%)
Cul9XP_011245024.1 Cul7 382..456 CDD:371573
APC10-like 1184..1314 CDD:382862
COG5647 <1736..1989 CDD:227934
Cullin <1740..1856 CDD:366357
RING_Ubox 2115..2166 CDD:388418 20/51 (39%)
RING-HC finger (C3HC4-type) 2116..2166 CDD:319361 20/50 (40%)
IBR 2187..2249 CDD:214763 17/62 (27%)
IBR <2280..2315 CDD:366672 20/34 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.