DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and si:ch211-278j3.3

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_696570.3 Gene:si:ch211-278j3.3 / 568165 ZFINID:ZDB-GENE-041014-147 Length:611 Species:Danio rerio


Alignment Length:317 Identity:85/317 - (26%)
Similarity:130/317 - (41%) Gaps:67/317 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RVEK----LN---TILQITPSLAKVLLLEHQWNNVAVVEKYRQDANALLVTARIKPPSVAVTDTA 119
            |:||    ||   ..:.:|||       ||:.     ||:.:.||.  |...|.....    .|.
Zfish    26 RIEKPTGTLNKEEVAITLTPS-------EHEH-----VEQAQGDAG--LEVCRFGGDG----GTG 72

  Fly   120 STSAAAASAQLLRLGSSGYKTTASATPQYRSQM------CPVCASSQLGDKFYSL-ACGHSFCKD 177
            ..|........:..||||.....|.:...:.|:      ||:|..||....|..| :|.|..|.|
Zfish    73 EGSVVGDEEGAVECGSSGSMAVLSLSSSSQEQLLEHLVECPLCLLSQPRAHFPRLSSCQHRACTD 137

  Fly   178 CWTIYFETQIFQGISTQIGCMAQMCNVRVPEDLVLTLVTRPVMRD-----KYQQFAFKDYVKSHP 237
            |...|...:|.:   :::|.....|    ||.|.|..| |.::.|     ::::|..:.::.:.|
Zfish   138 CLRQYLRIEISE---SRVGIACPQC----PEALALPDV-RAILDDGALLERFEEFQLRRFLAADP 194

  Fly   238 ELRFCPGPNCQIIV------QSSEISAKRAICKACHTGFCFRCGMDYHAPTDCQVIKKWL---TK 293
            :.|:||.|:|...|      :..::|..|   :.|.|.||:.|...:|....|...::..   |.
Zfish   195 DTRWCPAPDCSYAVIAYGCAECPKLSCGR---EGCETEFCYHCRQLWHPDQTCDQARRQRARHTS 256

  Fly   294 CADDSETANYI-------SAHTKDCPKCHICIEK--NGGCNHMQCFNCKHDFCWMCL 341
            .|:|..|. |:       :...|.||:|...|.|  :|.||.|.|..|...|||:|:
Zfish   257 GANDVSTL-YVFNEEPGDAEEIKPCPRCGAYIMKTNDGSCNRMNCTVCACQFCWLCM 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 17/59 (29%)
IBR 222..284 CDD:214763 17/72 (24%)
si:ch211-278j3.3XP_696570.3 IBR 179..244 CDD:214763 16/67 (24%)
IBR <276..314 CDD:279784 16/37 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.