DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and si:dkey-181m9.8

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_696033.5 Gene:si:dkey-181m9.8 / 567642 ZFINID:ZDB-GENE-070912-399 Length:867 Species:Danio rerio


Alignment Length:400 Identity:77/400 - (19%)
Similarity:127/400 - (31%) Gaps:153/400 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 QYRSQMCPVCASSQLGDKFYSLA-CGHSFCKDCWTIYFETQIFQGISTQIGCMAQMCNVRVPEDL 210
            :|....||:|......::..::. |..:||:.|:..||.:.|.:  ...:..:..:||:      
Zfish   446 KYLCHDCPICQEQVSFNRMVTMTHCSCTFCESCFKKYFSSVIKE--KNIVHAVCPLCNL------ 502

  Fly   211 VLTLVTRPVMR-----DKYQQFAFKD-----YVKSH-----------------PELRFCPGPNCQ 248
                   |.:|     |..:.|:..|     |:.|.                 |..|:|......
Zfish   503 -------PDVRGGRREDTMEYFSLLDTQIRYYLDSQIHELFQRKLRDRALQEMPNFRWCAHCCFG 560

  Fly   249 IIVQSSEISAKRAICKACHTGFCFRCGMDY---HAPTDCQVIKKWLTKCA---DDSETANYISAH 307
            ::.::..:   |..|.:|....||:|...:   |....|:..|:|....:   .:|.....:|.:
Zfish   561 LLHEADRL---RMDCPSCGKSTCFKCKRPWAPQHEGISCEKFKEWEQLNSPEYQNSRLEQLLSRN 622

  Fly   308 TKDCPKCHI-CIEKNGGCNHMQCFNCKHDFCWMC------------------------------- 340
            ..|||||.. .....|||.|.:|..|:|:||..|                               
Zfish   623 KIDCPKCKFRFFLARGGCLHFRCTQCQHEFCGGCSQPFKQGSTCNFSIECAAKGLHAHHPRNCLY 687

  Fly   341 -LGDWKT--------------------------HGSEYYECSRYKDNPNIANESVHVQAREALKK 378
             |.||..                          |.........:::...:..|:.   .|:|..:
Zfish   688 HLRDWSVPRLRTLLQRYGVSHPLMFSPKHPMGRHSKGICGVMEFQETGAVKEEAC---GRQAFPE 749

  Fly   379 Y-----LHYYE---------------------------RW-----ENHSKSLKLEQQTIDRLRQR 406
            |     |||.|                           ||     |.|  .|:.:|:..|||||.
Zfish   750 YSGYCTLHYKEVLVELINSNGLDPVVLLDGAELRAEMDRWKVPLPERH--PLEPDQRYDDRLRQI 812

  Fly   407 INSKVMNGSG 416
            :..:|:.|||
Zfish   813 LKERVVLGSG 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 11/53 (21%)
IBR 222..284 CDD:214763 15/86 (17%)
si:dkey-181m9.8XP_696033.5 UEV 26..142 CDD:283415
RRM_RBM43 316..393 CDD:240990
zf-RING_2 450..500 CDD:290367 10/51 (20%)
IBR 534..593 CDD:279784 10/61 (16%)
IBR 609..663 CDD:279784 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.