DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and rnf19a

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001313624.1 Gene:rnf19a / 557995 ZFINID:ZDB-GENE-030131-9414 Length:913 Species:Danio rerio


Alignment Length:278 Identity:68/278 - (24%)
Similarity:120/278 - (43%) Gaps:52/278 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 NNVAVVEK------YRQDANALLVTARIKPPSVAVTDTASTSAAAASAQLLRLGSSGYKTTASAT 145
            :.:|.||.      .:||..:.|..|     .||.|.::.:|::.::::||.             
Zfish   152 DGIASVESVHSEMCQQQDHASALSAA-----GVAYTSSSCSSSSGSTSELLE------------- 198

  Fly   146 PQYRSQMCPVCASSQLGDKFYS-LACGHSFCKDCWTIYFETQIFQGISTQIGCMAQMCNVRV-PE 208
                   ||:|......|:|.. :.|.|..|.||...|...:|.:   :::......|:.|. |.
Zfish   199 -------CPLCLLRHTRDRFPDIMTCHHRSCADCLRQYLRIEISE---SRVNISCPECSERFNPH 253

  Fly   209 DLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNC-QIIVQSSEISAKRAIC--KACHTGF 270
            |:.:.|..| |:.:||::|..:.::.:.|:.|:||.|:| ..::.....|..:..|  ..|.|.|
Zfish   254 DIRMILNDR-VLMEKYEEFMLRRWLVADPDCRWCPAPDCGYAVIAFGCASCPKITCGRDGCGTEF 317

  Fly   271 CFRCGMDYHAPTDCQV----------IKKWLTKCADDSETANYISAHTKDCPKCHICIEK--NGG 323
            |:.|...:|....|..          ::.:.:.....|:.:...:...|.||:|...|.|  :|.
Zfish   318 CYHCKQLWHPNQTCDAARQQRAQSLRLRPFRSSSLSYSQESGAAADDIKPCPRCAAYIIKMNDGS 382

  Fly   324 CNHMQCFNCKHDFCWMCL 341
            ||||.|..|..:|||:|:
Zfish   383 CNHMTCAVCGCEFCWLCM 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 13/53 (25%)
IBR 222..284 CDD:214763 17/64 (27%)
rnf19aNP_001313624.1 IBR 266..331 CDD:214763 17/64 (27%)
IBR <364..402 CDD:279784 17/37 (46%)
AzlC <428..517 CDD:294385
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.