DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and RNF216

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_996994.1 Gene:RNF216 / 54476 HGNCID:21698 Length:923 Species:Homo sapiens


Alignment Length:435 Identity:85/435 - (19%)
Similarity:156/435 - (35%) Gaps:108/435 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DDYDYYN---TGEDCDVERLDPKRADPEYFEYECLTVEDIE--------------KLLNERVEKL 66
            |.:||..   ..:.|.::..|...||     ::.|:.:||:              |.|::.::|.
Human   413 DFFDYSKLTPLDQRCFIQAADLLMAD-----FKVLSSQDIKWALHELKGHYAITRKALSDAIKKW 472

  Fly    67 NTILQITPSLAKVLLLEHQWNNVAVVE-KYRQ----------------------DANALLVTARI 108
            .   :::|..:.......|.|..:.:: |:.|                      |..|||     
Human   473 Q---ELSPETSGKRKKRKQMNQYSYIDFKFEQGDIKIEKRMFFLENKRRHCRSYDRRALL----- 529

  Fly   109 KPPSVAVTDTASTSAAAASAQ------LLRLGSSGYKTTASATPQYRSQM--CPVCASSQLGDKF 165
              |:|..............|:      .|::....|        |...|:  |..|......::.
Human   530 --PAVQQEQEFYEQKIKEMAEHEDFLLALQMNEEQY--------QKDGQLIECRCCYGEFPFEEL 584

  Fly   166 YSLACGHSFCKDCWTIYFETQIFQGISTQIGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFK 230
            ...|..|.|||:|...|.:..:|.....::.||...|....|...:..::.:.::...|::.|.:
Human   585 TQCADAHLFCKECLIRYAQEAVFGSGKLELSCMEGSCTCSFPTSELEKVLPQTILYKYYERKAEE 649

  Fly   231 DYVKSH-PELRFCPGPNCQIIVQSSEISAKRAIC--KACHTGFCFRC-GM-DYHAPTDCQVIKKW 290
            :...:: .||..||..:...::.|   ..||..|  ..|....|.:| |: ..|....|:.:.: 
Human   650 EVAAAYADELVRCPSCSFPALLDS---DVKRFSCPNPHCRKETCRKCQGLWKEHNGLTCEELAE- 710

  Fly   291 LTKCADDSETANYI-----SAHTKDCPKCHICIEKNGGCNHMQCFNCKHDFCWMC---LGDW--- 344
                .||.:....|     :|..:.|.||...:.|:.|||.|.| .|....|::|   :..:   
Human   711 ----KDDIKYRTSIEEKMTAARIRKCHKCGTGLIKSEGCNRMSC-RCGAQMCYLCRVSINGYDHF 770

  Fly   345 ----KTHGSEYYECSR-------YKDNPNIANESVHVQAREALKK 378
                ::.|:...||||       .:|:..:. |.:..:|.|..|:
Human   771 CQHPRSPGAPCQECSRCSLWTDPTEDDEKLI-EEIQKEAEEEQKR 814

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 14/54 (26%)
IBR 222..284 CDD:214763 15/66 (23%)
RNF216NP_996994.1 RING-HC_RBR_RNF216 570..626 CDD:319544 13/55 (24%)
RING-HC finger (C3HC4-type) 572..621 CDD:319544 12/48 (25%)
IBR 712..762 CDD:307574 16/50 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1812
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.