DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and Rnf144a

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001075879.1 Gene:Rnf144a / 500636 RGDID:1561737 Length:292 Species:Rattus norvegicus


Alignment Length:216 Identity:63/216 - (29%)
Similarity:97/216 - (44%) Gaps:16/216 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 TTASATPQYRSQM-----CPVCASSQLGDKFYSLA-CGHSFCKDCWTIYFETQIFQGISTQIGCM 198
            |||...|.:...:     |.:|......::..::| |...||..|...|.|..|.:|:.|.|.|.
  Rat     2 TTARYRPTWDLALDPLVSCKLCLGEYPAEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCP 66

  Fly   199 AQMC--NVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNCQIIVQSSEI---SA 258
            ...|  ...:.|:.:..:|...:|: :|::..|:..|...|...:||...||.:.|..:|   :.
  Rat    67 DAACPKQGHLQENEIECMVAAEIMQ-RYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDIGLQTP 130

  Fly   259 KRAICKACHTGFCFRCGMDYHAPTDCQVIKKWLTKCADDSETANYI---SAHTKDCPKCHICIEK 320
            :...||||...||..|...:|....|..... ::....::.:|..:   .|..|.||||.:.||:
  Rat   131 QLVQCKACDMEFCSACKARWHPGQGCPETMP-ISFLPGETSSAFKVEEGDAPIKRCPKCRVYIER 194

  Fly   321 NGGCNHMQCFNCKHDFCWMCL 341
            :.||..|.|.||||.|||.||
  Rat   195 DEGCAQMMCKNCKHAFCWYCL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 15/60 (25%)
IBR 222..284 CDD:214763 18/64 (28%)
Rnf144aNP_001075879.1 mRING-HC-C4C4_RBR_RNF144A 19..72 CDD:319691 15/52 (29%)
IBR 91..156 CDD:214763 18/65 (28%)
IBR <179..216 CDD:396187 21/37 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.