DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and Rnf144b

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001102351.1 Gene:Rnf144b / 364681 RGDID:1308856 Length:301 Species:Rattus norvegicus


Alignment Length:212 Identity:65/212 - (30%)
Similarity:88/212 - (41%) Gaps:43/212 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 CPVCASSQLGDKFYSL-ACGHSFCKDCWTIYFETQIFQGISTQIGCMAQMC--NVRVPEDLVLTL 214
            |.:|...|..||...| .|...||..|...|....|.:|..:.|.|...:|  :..:.|..:..|
  Rat    30 CKLCLCEQSLDKMTILQECQCIFCTPCLKQYMVLSIREGCGSPITCPDMVCLNHGTLQEAEIACL 94

  Fly   215 VTRPVMRDK---YQQFAFKDYVKSHPELRFCPGPNCQIIVQ------SSEISAKRAICKACHTGF 270
            |  ||  |:   ||:..|:..|...|...:||..:||.:..      ...:|.:   |.:||..|
  Rat    95 V--PV--DEFQLYQRLKFEREVHMDPLRTWCPVADCQTVCHITAGDPGQPVSVE---CPSCHLKF 152

  Fly   271 CFRCGMDYHAPTDCQVIKKWLTKCADDSETANYISAH-----------TKDCPKCHICIEKNGGC 324
            |..|...:|..:.|:           ||::|  :..|           .|.||.|.|.||:|.||
  Rat   153 CSCCKDAWHEESSCR-----------DSQSA--MPEHGALFGTDADSPIKQCPVCRIYIERNEGC 204

  Fly   325 NHMQCFNCKHDFCWMCL 341
            ..|.|.||||.|||.||
  Rat   205 AQMMCKNCKHTFCWYCL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 16/53 (30%)
IBR 222..284 CDD:214763 18/70 (26%)
Rnf144bNP_001102351.1 mRING-HC-C4C4_RBR_RNF144B 28..84 CDD:319692 16/53 (30%)
IBR 101..166 CDD:214763 17/67 (25%)
IBR <183..223 CDD:396187 21/39 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.