DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and LUBEL

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_723214.2 Gene:LUBEL / 33950 FlyBaseID:FBgn0031857 Length:2892 Species:Drosophila melanogaster


Alignment Length:451 Identity:96/451 - (21%)
Similarity:142/451 - (31%) Gaps:179/451 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TVEDIEKLLNERVEKLNTILQITPSLAKVLLLEHQWN---NVAVV----EKYRQDANALLVTARI 108
            ||..|.|..||...|.|:    ||...||.|....::   .::.|    |.|.|..::.:.|:|:
  Fly  2288 TVSKIPKPTNEPTNKSNS----TPLNKKVPLRSKSFSAPMGISSVKRIQEVYLQKQSSSIATSRV 2348

  Fly   109 KPPSVAVT----------------DTASTS--AAAASAQLLR----------------LGSSGYK 139
            ...|..||                |..|||  ||||:|.||:                .....|:
  Fly  2349 PLKSSPVTKKSINDAISRFNSNQADGPSTSGAAAAAAAALLKPRSQPRIPKKKYHETCFSDDDYE 2413

  Fly   140 TTAS---------ATPQYRSQM------------------------------------------- 152
            |:|:         |.||...|:                                           
  Fly  2414 TSATEEEQEEPNLAEPQKAEQLKRKMSMPVFRAYPSVQEPVIEDPAILARKYVDQELVTNIAEAQ 2478

  Fly   153 -----------------------------------CPVCASSQLGDKFYS-LACGHSFCKDCWTI 181
                                               |.:|.:|...::..| |.|.|..||.|...
  Fly  2479 IAATLVSMKFSEDVALWAARECSDLDQAIAMLQQECELCMNSYPMNQMVSMLKCLHKCCKQCAKS 2543

  Fly   182 YFETQIF-QGISTQIGCMAQMCNVRVPE------------------DLVLTLVTRPVMRDKYQQF 227
            ||..||. :.|:   .|....|  ::||                  |:.|..:....:.:.:|:.
  Fly  2544 YFTVQITDRSIN---DCSCPFC--KLPELSNEAQHEDEHLEYFSNLDIFLKSILDNDVHELFQRK 2603

  Fly   228 AFKDYVKSHPELRFCPGPNCQIIVQSSEISA----KRAICKACHTGFCFRCGMDY---HAPTDCQ 285
            .....:...|..::|       |..||...|    ||.||..|.:..|.:|...:   |..:.|:
  Fly  2604 LRDRSLLQDPNFKWC-------IQCSSGFFARPKQKRLICPDCGSVTCAQCRKPWERQHEGSSCE 2661

  Fly   286 VIKKWLTKCADDSE-----TANYISAHTKDCPKCHICIE-KNGGCNHMQCFNCKHDFCWMC 340
            ...:|  |..:|.|     ...:::.:..|||||..... ..|||.|..|..||.:||:.|
  Fly  2662 AYLEW--KRENDPELQAQGVQEHLAQNGIDCPKCKFRYSLARGGCMHFTCTQCKFEFCYGC 2720

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 18/132 (14%)
IBR 222..284 CDD:214763 15/68 (22%)
LUBELNP_723214.2 Bbox1_HOIP 89..132 CDD:380873
Med15 <336..>483 CDD:312941
ZnF_RBZ 737..761 CDD:197784
RanBP2-type Zn finger 738..757 CDD:275376
HOIP-UBA 1036..1184 CDD:406963
PRK01741 1199..>1402 CDD:234977
rne <1482..1771 CDD:236766
Streccoc_I_II <2159..>2307 CDD:411384 8/22 (36%)
RING-HC_RNF169 2513..2563 CDD:319465 17/54 (31%)
IBR 2598..2660 CDD:214763 15/68 (22%)
IBR <2690..2724 CDD:396187 14/31 (45%)
E3_UbLigase_RBR 2760..2858 CDD:407926
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1812
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.