DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and Rnf216

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001100592.1 Gene:Rnf216 / 304294 RGDID:1565135 Length:910 Species:Rattus norvegicus


Alignment Length:253 Identity:56/253 - (22%)
Similarity:102/253 - (40%) Gaps:37/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 CPVCASSQLGDKFYSLACGHSFCKDCWTIYFETQIFQGISTQIGCMAQMCNVRVPEDLVLTLVTR 217
            |..|......::....|..|.|||:|...|.:..:|....:::.||...|....|...:..::.:
  Rat   560 CRCCYGEFPFEELTQCADAHLFCKECLIRYAQEAVFGSGKSELSCMEGSCTCSFPTSELEKVLPQ 624

  Fly   218 PVMRDKYQQFAFKDYVKSH-PELRFCPGPNCQIIVQSSEISAKRAIC--KACHTGFCFRC-GM-D 277
            .::...|::.|.::...:: .||..||..:...::.|   ..||..|  ..|....|.:| |: .
  Rat   625 TILYKYYERKAEEEVAAAYADELVRCPSCSFPALLDS---DVKRFSCPNPRCRKETCRKCQGLWK 686

  Fly   278 YHAPTDCQVIKKWLTKCADDSETANYI-----SAHTKDCPKCHICIEKNGGCNHMQCFNCKHDFC 337
            .|....|:.:.:     .||.:....|     :|..:.|.||...:.|:.|||.|.| .|....|
  Rat   687 EHNGLTCEELAE-----KDDIKYRTSIEEKMTAARIRKCHKCGTGLIKSEGCNRMSC-RCGAQMC 745

  Fly   338 WMC---LGDW-------KTHGSEYYECSR-------YKDNPNIANESVHVQAREALKK 378
            ::|   :..:       ::.|:...||||       .:|:..:. |.:..:|.|..|:
  Rat   746 YLCRVSINGYDHFCQHPRSPGAPCQECSRCSLWTDPTEDDEKLI-EEIQKEAEEEQKR 802

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 13/50 (26%)
IBR 222..284 CDD:214763 15/66 (23%)
Rnf216NP_001100592.1 RING-HC_RBR_RNF216 558..614 CDD:319544 13/53 (25%)
IBR 700..750 CDD:396187 16/50 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1812
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.