DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and Rnf217

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001139821.1 Gene:Rnf217 / 268291 MGIID:3610311 Length:515 Species:Mus musculus


Alignment Length:230 Identity:60/230 - (26%)
Similarity:90/230 - (39%) Gaps:47/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 MCPVCASSQLGDKFYS--LACGHSFCKDCWTIYFETQIFQGISTQIGCMAQMCNVRVPEDLVLTL 214
            ||.||    |.||...  ..|..:.|::|..||..:|:..| ..:|.|....|...:.|..|:..
Mouse   235 MCRVC----LEDKPIKPLPCCKKAVCEECLKIYLSSQVQLG-QVEIKCPVTECFEFLEETTVVYN 294

  Fly   215 VTRPVMRD--KYQQFAFKDYVKSHPELRFCPGPNCQ----------IIVQSSEISAKRAICKACH 267
            :|.   .|  ||:.|.....:.|..:    |.|.|:          |...|...|..:..|..|.
Mouse   295 LTH---EDSIKYKYFLELGRIDSSTK----PCPQCKHFTTFKKKGHIPTPSRSESRYKIQCPTCQ 352

  Fly   268 TGFCFRCGMDYHAPTDCQVIKK-------WLTKCADDSETANYISAHTKDCPKCHICIEKNGGCN 325
            ..:||:|...:|...:|:..||       |.::.......|       :.||||.|.|::..||:
Mouse   353 LIWCFKCHSPWHEGVNCKEYKKGDKLLRHWASEIEHGQRNA-------QKCPKCKIHIQRTEGCD 410

  Fly   326 HMQCFNCKHDFCWMCLGDWKTHGSEYYECSRYKDN 360
            ||.|..|..:||:.|       |..|.:...:.|:
Mouse   411 HMTCSQCNTNFCYRC-------GERYRQLRFFGDH 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 17/53 (32%)
IBR 222..284 CDD:214763 17/73 (23%)
Rnf217NP_001139821.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..125
Tankyrase_bdg_C <62..131 CDD:291973
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..189
TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 232..451 60/230 (26%)
IBR 302..369 CDD:214763 16/70 (23%)
IBR <397..429 CDD:279784 15/38 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.