DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and RNF19A

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001267468.1 Gene:RNF19A / 25897 HGNCID:13432 Length:838 Species:Homo sapiens


Alignment Length:215 Identity:56/215 - (26%)
Similarity:93/215 - (43%) Gaps:39/215 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 CPVCASSQLGDKFYS-LACGHSFCKDCWTIYFETQIFQGISTQIGCMAQMCNVRV-PEDLVLTLV 215
            ||:|......|:|.. :.|.|..|.||...|...:|.:   :::......|..|. |.|:.| ::
Human   132 CPLCLLRHSKDRFPDIMTCHHRSCVDCLRQYLRIEISE---SRVNISCPECTERFNPHDIRL-IL 192

  Fly   216 TRPVMRDKYQQFAFKDYVKSHPELRFCPGPNC-QIIVQSSEISAKRAIC--KACHTGFCFRCGMD 277
            :..|:.:||::|..:.::.:.|:.|:||.|:| ..::.....|..:..|  :.|.|.||:.|...
Human   193 SDDVLMEKYEEFMLRRWLVADPDCRWCPAPDCGYAVIAFGCASCPKLTCGREGCGTEFCYHCKQI 257

  Fly   278 YHAPTDCQVIKKWLTKCADDSETANYISAHT-------------------KDCPKCHICIEK--N 321
            :|....|...::         |.|..:...|                   |.||:|...|.|  :
Human   258 WHPNQTCDAARQ---------ERAQSLRLRTIRSSSISYSQESGAAADDIKPCPRCAAYIIKMND 313

  Fly   322 GGCNHMQCFNCKHDFCWMCL 341
            |.||||.|..|..:|||:|:
Human   314 GSCNHMTCAVCGCEFCWLCM 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 13/51 (25%)
IBR 222..284 CDD:214763 17/64 (27%)
RNF19ANP_001267468.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..61
TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 128..351 56/215 (26%)
RING-HC_RBR_RNF19A 131..185 CDD:319689 14/55 (25%)
RING-HC finger (C3HC4-type) 132..179 CDD:319689 12/49 (24%)
IBR 199..264 CDD:214763 17/64 (27%)
IBR <297..335 CDD:307574 17/37 (46%)
AzlC <361..450 CDD:321048
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 622..685
Interaction with CASR. /evidence=ECO:0000269|PubMed:16513638 660..838
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 700..721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.