DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and CUL9

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_011512724.1 Gene:CUL9 / 23113 HGNCID:15982 Length:2566 Species:Homo sapiens


Alignment Length:441 Identity:115/441 - (26%)
Similarity:181/441 - (41%) Gaps:67/441 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LTVEDIEKLLNERVEKLNTILQITPSLAKVLLLEHQWNNVAVVEKYRQDANALLVTARIKPPSVA 114
            ::.:::|.|:.:.|.::...|.:.|.:|:.||....|....:::.|.:|...||:.|        
Human  2046 MSPQEVEGLMKQTVRQVQETLNLEPDVAQHLLAHSHWGAEQLLQSYSEDPEPLLLAA-------- 2102

  Fly   115 VTDTASTSAAAASAQLLRLGSSGYKTTASATPQYRSQMCPVCASSQLG--DKFYSLACGHSFCKD 177
                               |...::  |.|.| .|...||||. |.||  |...||.|.|..||.
Human  2103 -------------------GLCVHQ--AQAVP-VRPDHCPVCV-SPLGCDDDLPSLCCMHYCCKS 2144

  Fly   178 CWTIYFETQIFQGISTQIGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFC 242
            ||..|..|:|.|.:.....|....|..:.....:..:|:.|.:..||::...:.||:|...|.:|
Human  2145 CWNEYLTTRIEQNLVLNCTCPIADCPAQPTGAFIRAIVSSPEVISKYEKALLRGYVESCSNLTWC 2209

  Fly   243 PGP-NCQIIVQSSEISAKRAICKACHTGFCFRCGM-DYHAPTDCQVIKKWLTKCADD-------- 297
            ..| .|..|:....:.. ...|..|....||.|.. :.|.|..|..:.:|:    ||        
Human  2210 TNPQGCDRILCRQGLGC-GTTCSKCGWASCFNCSFPEAHYPASCGHMSQWV----DDGGYYDGMS 2269

  Fly   298 --SETANYISAHTKDCPKCHICIEKNGGCNHMQCFNCKHDFCWMCLGDWKTHGSEYYECSRYKDN 360
              :::.:.....:|.||.|...||||.||.||.|..|.|.|||.||..||.:..:||.||     
Human  2270 VEAQSKHLAKLISKRCPSCQAPIEKNEGCLHMTCAKCNHGFCWRCLKSWKPNHKDYYNCS----- 2329

  Fly   361 PNIANESVHVQAREALKKYLHYYERWENHSKSLKLEQQTIDRLRQRINSKVMNGSGTWIDWQYLF 425
                 ..|...||:. |::..|.||...|.::    ::....||.|:::  ::.......:.:|.
Human  2330 -----AMVSKAARQE-KRFQDYNERCTFHHQA----REFAVNLRNRVSA--IHEVPPPRSFTFLN 2382

  Fly   426 NAAALLAKCRYTLQYTYPYAYYMEAGSRKNLFEYQQAQLEAEIENLSWKIE 476
            :|...|.:.|..|.|...|::|.:.....::.|.|...||.....|...:|
Human  2383 DACQGLEQARKVLAYACVYSFYSQDAEYMDVVEQQTENLELHTNALQILLE 2433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 22/54 (41%)
IBR 222..284 CDD:214763 17/63 (27%)
CUL9XP_011512724.1 Cul7 366..440 CDD:288381
UBA2_C <593..638 CDD:292812
APC10-like 1167..1297 CDD:295192
CULLIN 1642..1813 CDD:214545
Cullin_Nedd8 1913..1993 CDD:299553
zf-RING_2 2117..2166 CDD:290367 21/49 (43%)
IBR 2190..2252 CDD:214763 17/62 (27%)
IBR <2283..2321 CDD:279784 22/37 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.