DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and C17H11.6

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001123112.1 Gene:C17H11.6 / 181076 WormBaseID:WBGene00015926 Length:893 Species:Caenorhabditis elegans


Alignment Length:312 Identity:72/312 - (23%)
Similarity:122/312 - (39%) Gaps:82/312 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 DANALLVTARIKPPSVAVTDTASTSAAAASAQLLRLGSSGYKTTASA------------------ 144
            |.||    ..:...||:.:|..|..:.:.|::..|...:|....:.|                  
 Worm   108 DDNA----GHVAMTSVSSSDVRSNVSGSISSKRYRGSDTGSGMDSEAGETCAEMLLSSRNQDDEE 168

  Fly   145 -------------TPQYRSQM----------CPVCASSQLGDKFYSL-ACGHSFCKDCWTIYFET 185
                         ||:..|::          ||:||:...|..|..| .|.|..|:.|...|.|.
 Worm   169 QSDEKQLSQSLPDTPKTPSEVGKKGKGKMKECPLCAAKMPGSAFPKLKGCQHRSCRACLRQYVEL 233

  Fly   186 QIFQGISTQIGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNCQII 250
            .|.:. ..::.| .:..:...|.|:.:.:...|.:.:||:.|:.:.|:.:..:.|:||.|:|..:
 Worm   234 SITEN-RVEVPC-PECSSYLHPNDIKMLIGDIPTLIEKYEAFSLRRYLMTEADARWCPAPDCGFV 296

  Fly   251 VQSSEISAKRAICKA-------CHTGFCFRCGMDYHAPTDC-----------------QVIKKWL 291
            .    |:.|.|.|..       |.|.||:.|..::|:...|                 ::::...
 Worm   297 F----IATKCAACPQLKCQRPDCGTLFCYHCKREWHSNQTCDEARRPEKRKSRGLAFEEIMRTGF 357

  Fly   292 TKCADDSETANYISAHTKDCPKCHICIEK--NGGCNHMQCFNCKHDFCWMCL 341
            .:.||.:.....:.|    ||:|...|.|  :|.||||.|..|..:|||:||
 Worm   358 HQSADSTLKPGDVKA----CPRCKTYIVKMDDGSCNHMVCTMCNAEFCWLCL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 15/63 (24%)
IBR 222..284 CDD:214763 19/68 (28%)
C17H11.6NP_001123112.1 IBR 268..333 CDD:214763 19/68 (28%)
IBR <369..407 CDD:279784 18/41 (44%)
AzlC <433..529 CDD:294385
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.