DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and Rnf144a

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_006515007.1 Gene:Rnf144a / 108089 MGIID:1344401 Length:313 Species:Mus musculus


Alignment Length:219 Identity:64/219 - (29%)
Similarity:97/219 - (44%) Gaps:20/219 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 TASATPQYRSQ---------MCPVCASSQLGDKFYSLA-CGHSFCKDCWTIYFETQIFQGISTQI 195
            :|..|.:||..         .|.:|......::..::| |...||..|...|.|..|.:|:.|.|
Mouse    20 SAMTTARYRPTWDLALDPLVSCKLCLGEYPAEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAI 84

  Fly   196 GCMAQMC--NVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNCQIIVQSSEI-- 256
            .|....|  ...:.|:.:..:|...:|: :|::..|:..|...|...:||...||.:.|..:|  
Mouse    85 SCPDAACPKQGHLQENEIECMVAAEIMQ-RYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDIGL 148

  Fly   257 -SAKRAICKACHTGFCFRCGMDYHAPTDCQVIKKWLTKCADDSETANYI---SAHTKDCPKCHIC 317
             :.:...||||...||..|...:|....|..... :|....::.:|..:   .|..|.||||.:.
Mouse   149 QTPQLVQCKACDMEFCSACKARWHPGQGCPETMP-ITFLPGETSSAFKMEEGDAPIKRCPKCRVY 212

  Fly   318 IEKNGGCNHMQCFNCKHDFCWMCL 341
            ||::.||..|.|.||||.|||.||
Mouse   213 IERDEGCAQMMCKNCKHAFCWYCL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 15/64 (23%)
IBR 222..284 CDD:214763 18/64 (28%)
Rnf144aXP_006515007.1 mRING-HC-C4C4_RBR_RNF144A 40..93 CDD:319691 15/52 (29%)
IBR 112..177 CDD:214763 18/65 (28%)
IBR <200..237 CDD:366672 21/37 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.