DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and LOC100334178

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_009296840.2 Gene:LOC100334178 / 100334178 -ID:- Length:1052 Species:Danio rerio


Alignment Length:353 Identity:71/353 - (20%)
Similarity:117/353 - (33%) Gaps:84/353 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 VAVTDTASTSAAAASAQLLRLGSSGYKTTASATPQYR------------SQMCPVCASSQLGDKF 165
            :||.|..|.........|||..::.| |........|            ::.||:|.|.....|.
Zfish   636 LAVFDLPSWGRCELILSLLRDPAANY-TLEDVVQAVRESPDRDFIRRVLNKECPICLSVFPHSKM 699

  Fly   166 YSL-ACGHSFCKDCWTIYFETQIFQGISTQIGCMAQMC---NVRVPEDLVLTLVTRPV-MRDKYQ 225
            .|| :|..|.|..|:..:|...:.......:.|  .:|   ::..||.|.....|..: :||..:
Zfish   700 RSLTSCQCSVCCGCFQQHFTIAVRDKHIRDMVC--PVCTEPDINDPEHLNSYFSTLDIQLRDCLE 762

  Fly   226 QFAFKDYVK--------SHPELRFCPGPNCQIIVQSSEISAKRAICKACHTGFCFRCGMDY---H 279
            |..::.:.|        ..|:..:|...:...|....::   :..|..|...||.:|...:   |
Zfish   763 QEVYELFHKKLTEQALIKDPKFLWCSHCSYGFIYDDDQL---KVTCSQCRKSFCAQCKKTWEPQH 824

  Fly   280 APTDCQVIKKWLTKCADDSE-----TANYISAHTKDCPKCHICIE-KNGGCNHMQCFNCKHDFCW 338
            ....|:..:.|  |..:|.|     .|.|:..:...||.|..... ..|||.|..|..|::.||.
Zfish   825 MGLSCEQFQLW--KRENDPEYQRQGLAGYLRDNGITCPNCRFQYALARGGCMHFSCSQCRYQFCS 887

  Fly   339 MCLGDWKT------------HGSEYYECSRYKDNPNIANESVHVQAREALKKYLHYYERWENHSK 391
            .|...:.|            |.....:|                         |.|...||....
Zfish   888 GCNNPFHTTCAVNQCTVTGLHAHHPRDC-------------------------LFYLRDWEPARL 927

  Fly   392 SLKLEQQTIDRLRQRINSKVMNGSGTWI 419
            ...|:::.::     .|::...|:.|.:
Zfish   928 QALLQKKGVN-----YNTETAPGAQTGV 950

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 14/56 (25%)
IBR 222..284 CDD:214763 12/72 (17%)
LOC100334178XP_009296840.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1812
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.