DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alp8 and arnt2

DIOPT Version :9

Sequence 1:NP_001286709.1 Gene:Alp8 / 37540 FlyBaseID:FBgn0034712 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_012813827.1 Gene:arnt2 / 100101693 XenbaseID:XB-GENE-487404 Length:723 Species:Xenopus tropicalis


Alignment Length:240 Identity:53/240 - (22%)
Similarity:84/240 - (35%) Gaps:49/240 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 SSLSFERFPYTG-LSRTYCSNAQVPDSACTATAYLCGVKTNIVNIGVSAAVEYNNCTASQDPANR 184
            ||.:|:. ||:. :....|:|..|..           |:.....:.|......::...||.|   
 Frog   423 SSFTFQN-PYSDEIEYIICTNTNVKQ-----------VQQQQAELEVHPRDSLSSYDLSQVP--- 472

  Fly   185 LTSIAEWAQNAGKSTGIVTTTTLTHASPSGAYAKTAN-RMWECDTDVTSYGVDANSCIDMATQLV 248
            :.::|......|||  :|.       .|...:::..: |..|....:|:......|.....||.:
 Frog   473 VPNLAANVHEGGKS--VVD-------KPDPIFSQDRDPRFAEMFAGITASEKKMLSASGSGTQQL 528

  Fly   249 TQTPGKNFEVMFGGGMGKFLPNSIVDSHG-----NPGERSDGVNLLSRWQGLHDGGVLVTNR--- 305
            ..| |..|:   .|..||...:|:|...|     :|.  :.|.||....:.::.|.|...:|   
 Frog   529 YST-GSPFQ---PGHSGKSFSSSVVHVTGVNEIQSPS--ATGQNLTQISRQMNAGQVWTGSRPPF 587

  Fly   306 --NQLLKLNVSAVSSVIGLFQSKLMNFHLEADD--TYQPTLSELT 346
              .|:........||..|:..|     |....|  ||.|..|..|
 Frog   588 QGQQIASQTSKPQSSPFGIGTS-----HTYTSDPSTYSPLSSPAT 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alp8NP_001286709.1 ALP_like 88..525 CDD:304875 53/240 (22%)
arnt2XP_012813827.1 HLH 72..124 CDD:278439
PAS 144..250 CDD:279347
PAS 147..206 CDD:214512
PAS_11 343..443 CDD:291273 6/20 (30%)
PAS 343..439 CDD:238075 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1785
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.