DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swim and CTSF

DIOPT Version :9

Sequence 1:NP_611652.2 Gene:Swim / 37537 FlyBaseID:FBgn0034709 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_003784.2 Gene:CTSF / 8722 HGNCID:2531 Length:484 Species:Homo sapiens


Alignment Length:253 Identity:66/253 - (26%)
Similarity:105/253 - (41%) Gaps:42/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 KEPTYRVKAMTRLKNPTDGLPSSFNALDKWSS--YISEVPDQGWCGASWVLSTT-SVASDRFAIQ 229
            |||..::|   :.|:..|..|..::    |.|  .:::|.|||.||:.|..|.| :|....|..|
Human   255 KEPGNKMK---QAKSVGDLAPPEWD----WRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQ 312

  Fly   230 SKGKENVQLSAQNILSCTRRQQGCEGGHLDAAWRYLHKKGVVD-ENCYPYTQHRDTCKIRHNSRS 293
            .   ..:.||.|.:|.|.:..:.|.||....|:..:...|.:: |:.|.|..|..:|..      
Human   313 G---TLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNF------ 368

  Fly   294 LRANGCQKPVNVDRDSLYTVGPAYSLNREADIMAEIFHSGPVQATMRVNRDFFAYSGGVYRETAA 358
                      :.::..:|..........|..:.|.:...||:...:.      |:....||...:
Human   369 ----------SAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAIN------AFGMQFYRHGIS 417

  Fly   359 NRKAPTGF-----HSVKLVGWGEEHNGEKYWIAANSWGSWWGEHGYFRILRGSNECGI 411
            ....|...     |:|.|||:| ..:...:|...||||:.|||.||:.:.|||..||:
Human   418 RPLRPLCSPWLIDHAVLLVGYG-NRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGV 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SwimNP_611652.2 Somatomedin_B 41..83 CDD:279385
VWC 91..>126 CDD:302663
Peptidase_C1A_CathepsinB 188..417 CDD:239111 60/233 (26%)
CTSFNP_003784.2 Inhibitor_I29 187..243 CDD:214853
Peptidase_C1 271..482 CDD:278538 60/234 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149684
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.