DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swim and AT1G02300

DIOPT Version :9

Sequence 1:NP_611652.2 Gene:Swim / 37537 FlyBaseID:FBgn0034709 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_563647.1 Gene:AT1G02300 / 839576 AraportID:AT1G02300 Length:379 Species:Arabidopsis thaliana


Alignment Length:345 Identity:114/345 - (33%)
Similarity:148/345 - (42%) Gaps:78/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LTDDAIVHSVNSIHRLGWSARKYDQWWGRKYSEGLKLRLG---TKEPTYRVKAMTR----LKNPT 184
            :..:.||..||.....||.|...|::.....:| .|..||   |.:..|....:.|    ||   
plant    42 ILQNEIVKEVNENPNAGWKAAFNDRFANATVAE-FKRLLGVIQTPKTAYLGVPIVRHDLSLK--- 102

  Fly   185 DGLPSSFNALDKWS----------SYI-------SEVPDQGW-----CGASWVLSTTSVASDRFA 227
              ||..|:|...||          .||       |.:....|     ||:.|........||||.
plant   103 --LPKEFDARTAWSHCTSIRRILVGYILNNVLLWSTITLWFWFLLGHCGSCWAFGAVESLSDRFC 165

  Fly   228 IQSKGKENVQLSAQNILSCTRR--QQGCEGGHLDAAWRYLHKKGVVDENCYPYTQHRDTCKIRHN 290
            |  |...||.|||.::::|...  ..||.||....||.|....|||.:.|.||..:         
plant   166 I--KYNLNVSLSANDVIACCGLLCGFGCNGGFPMGAWLYFKYHGVVTQECDPYFDN--------- 219

  Fly   291 SRSLRANGCQKP-------------VNVDRDSL------YTVGPAYSLNRE-ADIMAEIFHSGPV 335
                  .||..|             ..|.|:.|      |.|| ||.:|.: .|||||::.:|||
plant   220 ------TGCSHPGCEPTYPTPKCERKCVSRNQLWGESKHYGVG-AYRINPDPQDIMAEVYKNGPV 277

  Fly   336 QATMRVNRDFFAYSGGVYRETAANRKAPTGFHSVKLVGWGEEHNGEKYWIAANSWGSWWGEHGYF 400
            :....|..||..|..|||:.....:   .|.|:|||:|||...:||.||:.||.|...||:.|||
plant   278 EVAFTVYEDFAHYKSGVYKYITGTK---IGGHAVKLIGWGTSDDGEDYWLLANQWNRSWGDDGYF 339

  Fly   401 RILRGSNECGIEEYVLASWP 420
            :|.||:||||||:.|:|..|
plant   340 KIRRGTNECGIEQSVVAGLP 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SwimNP_611652.2 Somatomedin_B 41..83 CDD:279385
VWC 91..>126 CDD:302663
Peptidase_C1A_CathepsinB 188..417 CDD:239111 94/272 (35%)
AT1G02300NP_563647.1 Propeptide_C1 43..85 CDD:311860 12/42 (29%)
Peptidase_C1A_CathepsinB 104..357 CDD:239111 94/273 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.