DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swim and AT4G01610

DIOPT Version :9

Sequence 1:NP_611652.2 Gene:Swim / 37537 FlyBaseID:FBgn0034709 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_567215.1 Gene:AT4G01610 / 826792 AraportID:AT4G01610 Length:359 Species:Arabidopsis thaliana


Alignment Length:334 Identity:114/334 - (34%)
Similarity:157/334 - (47%) Gaps:54/334 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 DLCLTDDAIVHSVNSIHRLGWSARKYDQWWGRKYSEGLKLRLGTKEPTYR-----VKAMTRLKNP 183
            |..:..|.||..||.....||.|...|::.....:| .|..||.| ||.:     |..::.  :|
plant    39 DSKILQDEIVKKVNENPNAGWKAAINDRFSNATVAE-FKRLLGVK-PTPKKHFLGVPIVSH--DP 99

  Fly   184 TDGLPSSFNALDKW--SSYISEVPDQGWCGASWVLSTTSVASDRFAIQSKGKENVQLSAQNILSC 246
            :..||.:|:|...|  .:.|..:.|||.||:.|........||||.||.  ..|:.||..::|:|
plant   100 SLKLPKAFDARTAWPQCTSIGNILDQGHCGSCWAFGAVESLSDRFCIQF--GMNISLSVNDLLAC 162

  Fly   247 T--RRQQGCEGGHLDAAWRYLHKKGVVDENCYPYTQHRDTCKIRHNSRSLRANGCQKP------- 302
            .  |...||:||:..|||:|....|||.|.|.||..:               .||..|       
plant   163 CGFRCGDGCDGGYPIAAWQYFSYSGVVTEECDPYFDN---------------TGCSHPGCEPAYP 212

  Fly   303 ------VNVDRDSLYTVGPAYSL------NREADIMAEIFHSGPVQATMRVNRDFFAYSGGVYRE 355
                  ..|..:.|::....||:      :...|||||::.:|||:.:..|..||..|..|||:.
plant   213 TPKCSRKCVSDNKLWSESKHYSVSTYTVKSNPQDIMAEVYKNGPVEVSFTVYEDFAHYKSGVYKH 277

  Fly   356 -TAANRKAPTGFHSVKLVGWGEEHNGEKYWIAANSWGSWWGEHGYFRILRGSNECGIEEYVLASW 419
             |.:|    .|.|:|||:|||....||.||:.||.|...||:.|||.|.||:||||||:..:|..
plant   278 ITGSN----IGGHAVKLIGWGTSSEGEDYWLMANQWNRGWGDDGYFMIRRGTNECGIEDEPVAGL 338

  Fly   420 PYVYSYYNV 428
            |...:.:.|
plant   339 PSSKNVFRV 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SwimNP_611652.2 Somatomedin_B 41..83 CDD:279385
VWC 91..>126 CDD:302663 1/1 (100%)
Peptidase_C1A_CathepsinB 188..417 CDD:239111 91/252 (36%)
AT4G01610NP_567215.1 Propeptide_C1 43..85 CDD:311860 15/43 (35%)
Peptidase_C1A_CathepsinB 104..337 CDD:239111 91/253 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.