DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swim and ctsc

DIOPT Version :10

Sequence 1:NP_611652.2 Gene:Swim / 37537 FlyBaseID:FBgn0034709 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_012812143.2 Gene:ctsc / 407938 XenbaseID:XB-GENE-940480 Length:458 Species:Xenopus tropicalis


Alignment Length:110 Identity:25/110 - (22%)
Similarity:40/110 - (36%) Gaps:31/110 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WLVMLAVLSIALSDGAAPEHDVVKSRQKRIVFPLNAAIGI--LFAIAVPLGIPSSNIFMSYNFEG 69
            |:::..|..|..|......:....:..:.|:..|...||:  ||.| :|..|.:|..|:.     
 Frog   475 WIIVFIVCLIVTSVTEVASNPATITIFQPILSSLAEGIGVNPLFVI-IPATISASCAFLL----- 533

  Fly    70 NYNSPQDANVFTEG-----------------------FGNYIKGI 91
            ...:|.:|.||:.|                       ||.|:.||
 Frog   534 PVANPPNAIVFSYGHLTVPDMIKAGLGTNVISMLALWFGLYVWGI 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SwimNP_611652.2 Somatomedin_B 41..84 CDD:460034 14/67 (21%)
Peptidase_C1A_CathepsinB 188..417 CDD:239111
ctscXP_012812143.2 CathepsinC_exc 20..136 CDD:462598
Peptidase_C1A_CathepsinC 226..455 CDD:239112
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.