DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swim and CG11459

DIOPT Version :9

Sequence 1:NP_611652.2 Gene:Swim / 37537 FlyBaseID:FBgn0034709 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster


Alignment Length:343 Identity:93/343 - (27%)
Similarity:136/343 - (39%) Gaps:63/343 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 YFSKYNTTWDNCNEC-RCLEGGSVQCDEDLCLTDDAIVHSVNSIHRLGWSARKYDQWWGRKYSEG 160
            |.:|||..:.|.::. |.|....|           ..|.|.|.::..|..|          :..|
  Fly    33 YKAKYNKQYRNRDKYHRALYEQRV-----------LAVESHNQLYLQGKVA----------FKMG 76

  Fly   161 LKLRLGTKEP---TYRVKAMTRLKNPTDGLPSSFN---------ALDKWS--SYISEVPDQGW-C 210
            |.....|.:.   .||......|:..|:.|..:.|         .:| |.  .|||.|.|||. |
  Fly    77 LNKFSDTDQRILFNYRSSIPAPLETSTNALTETVNYKRYDQITEGID-WRQYGYISPVGDQGTEC 140

  Fly   211 GASWVLSTTSVASDRFAIQSKGKENVQLSAQNILSCT-RRQQGCEGGHLDAAWRYLHKKGVVDEN 274
            .:.|..||:.|.....|  .|....|.||.::::.|. ....||.||.:..|:.|....|:..:.
  Fly   141 LSCWAFSTSGVLEAHMA--KKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNYTRDHGIATKE 203

  Fly   275 CYPYTQHRDTCKIRHNSRSLRANGCQKPVNVDRDSLYTVGPAYSLNREADIMAEIFHSGPVQATM 339
            .|||......|..:.:..:...:|.....|.|               |.::...:::.|||..::
  Fly   204 SYPYEPVSGECLWKSDRSAGTLSGYVTLGNYD---------------ERELAEVVYNIGPVAVSI 253

  Fly   340 -RVNRDFFAYSGGVYRETAANRKAPTGFHSVKLVGWGEEHNGEKYWIAANSWGSWWGEHGYFRIL 403
             .::.:|..|||||....|...|.....|||.|||:|.......|||..||:|:.|||.||.::.
  Fly   254 DHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLA 318

  Fly   404 RGSNE-CGIEEYVLASWP 420
            |.:|. ||:     ||.|
  Fly   319 RNANNMCGV-----ASLP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SwimNP_611652.2 Somatomedin_B 41..83 CDD:279385
VWC 91..>126 CDD:302663 8/29 (28%)
Peptidase_C1A_CathepsinB 188..417 CDD:239111 69/243 (28%)
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 16/72 (22%)
Peptidase_C1A 120..334 CDD:239068 71/235 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452963
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.