DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swim and Ctsf

DIOPT Version :9

Sequence 1:NP_611652.2 Gene:Swim / 37537 FlyBaseID:FBgn0034709 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001029282.1 Gene:Ctsf / 361704 RGDID:1308181 Length:462 Species:Rattus norvegicus


Alignment Length:260 Identity:72/260 - (27%)
Similarity:107/260 - (41%) Gaps:40/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 TKEPTYRVKAMTRLKNPTDG---LPSSFNAL--DKW----SSYISEVPDQGWCGASWVLSTTSVA 222
            |:|..:.:.....|:..:.|   |..|.|.|  .:|    ...::||.|||.||:.|..|.|...
  Rat   218 TEEEFHTIYLNPLLQKESGGKMSLAKSINDLAPPEWDWRKKGAVTEVKDQGMCGSCWAFSVTGNV 282

  Fly   223 SDRFAIQSKGKENVQLSAQNILSCTRRQQGCEGGHLDAAWRYLHKKGVVD-ENCYPYTQHRDTCK 286
            ..::.: ::| ..:.||.|.:|.|.:..:.|.||....|:..:...|.:: |:.|.|..|...|.
  Rat   283 EGQWFL-NRG-TLLSLSEQELLDCDKMDKACMGGLPSNAYTAIKNLGGLETEDDYGYQGHVQACN 345

  Fly   287 IRHNSRSLRANGCQKPVNVDRDSLYTVGPAYSLNREADIMAEIFHSGPVQATMRVNRDFFAYSGG 351
            .......:..|   ..|.:.||             |..|.|.:...||:...:.      |:...
  Rat   346 FSTQMAKVYIN---DSVELSRD-------------ENKIAAWLAQKGPISVAIN------AFGMQ 388

  Fly   352 VYRETAANRKAPTGF-----HSVKLVGWGEEHNGEKYWIAANSWGSWWGEHGYFRILRGSNECGI 411
            .||...|:...|...     |:|.|||:|...| ..||...||||..|||.||:.:.|||..||:
  Rat   389 FYRHGIAHPFRPLCSPWFIDHAVLLVGYGNRSN-IPYWAIKNSWGRDWGEEGYYYLYRGSGACGV 452

  Fly   412  411
              Rat   453  452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SwimNP_611652.2 Somatomedin_B 41..83 CDD:279385
VWC 91..>126 CDD:302663
Peptidase_C1A_CathepsinB 188..417 CDD:239111 67/236 (28%)
CtsfNP_001029282.1 Inhibitor_I29 165..221 CDD:214853 1/2 (50%)
Peptidase_C1 249..460 CDD:395062 64/229 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.