DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swim and CG5367

DIOPT Version :9

Sequence 1:NP_611652.2 Gene:Swim / 37537 FlyBaseID:FBgn0034709 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster


Alignment Length:399 Identity:93/399 - (23%)
Similarity:143/399 - (35%) Gaps:118/399 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CYCDEFCD---------RDDSSDCCPDYRSFCIGEVDPIISCEHNGVYFSKYNTTWDNCNECRCL 114
            |.|...|.         ...|::|..::..|           ::|.  ..||..|:|.....:..
  Fly     9 CLCGLNCQIVTSNLSEGNSSSANCKSEFEKF-----------KNNN--NRKYLRTYDEMRSYKAF 60

  Fly   115 EGGSVQCDEDLCLTDDAIVHSVNSIHRLGWSARKYDQWWGRKYSEGLKLRLGTKEPTYRVKAMTR 179
            |......:|          |:.|                   |.||        :.::|:|....
  Fly    61 EENFKVIEE----------HNQN-------------------YKEG--------QTSFRLKPNIF 88

  Fly   180 LKNPTDGLPSSFNALDK--------------WSSYISEVPDQ-GW--------------CGASWV 215
            ....|||....|..|.|              .|..::.||:. .|              ||:.:.
  Fly    89 ADMSTDGYLKGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKGFITPPYNQLSCGSCYA 153

  Fly   216 LS-TTSVASDRFAIQSKGKENVQLSAQNILSC--TRRQQGCEGGHLDAAWRYLHKK-GVVDENCY 276
            .| ..|:....|  :..|| .:.||.|.|:.|  :...|||.||.|.....||... |::.:..|
  Fly   154 FSIAESIMGQVF--KRTGK-ILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMRDQDY 215

  Fly   277 PYTQHRDTCKIRHNSRSLRANGCQKPVNVDRDSLYTVGPAYSLNREADIMAEIFHSGPVQATMRV 341
            ||...:..|:...:         ...|||...::..|      ..|..|.|.:.|.|||..::..
  Fly   216 PYVARKGKCQFVPD---------LSVVNVTSWAILPV------RDEQAIQAAVTHIGPVAISINA 265

  Fly   342 N-RDFFAYSGGVYRETAANRKAPTGFHSVKLVGWGEEHNGEKYWIAANSWGSWWGEHGYFRILRG 405
            : :.|..||.|:|.:...:..:..  |::.::|:|::     |||..|.||..|||:||.||.:|
  Fly   266 SPKTFQLYSDGIYDDPLCSSASVN--HAMVVIGFGKD-----YWILKNWWGQNWGENGYIRIRKG 323

  Fly   406 SNECGIEEY 414
            .|.|||..|
  Fly   324 VNMCGIANY 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SwimNP_611652.2 Somatomedin_B 41..83 CDD:279385 6/32 (19%)
VWC 91..>126 CDD:302663 7/34 (21%)
Peptidase_C1A_CathepsinB 188..417 CDD:239111 70/261 (27%)
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 17/109 (16%)
Peptidase_C1A 128..336 CDD:239068 65/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452961
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.