DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swim and CtsB1

DIOPT Version :9

Sequence 1:NP_611652.2 Gene:Swim / 37537 FlyBaseID:FBgn0034709 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster


Alignment Length:328 Identity:105/328 - (32%)
Similarity:149/328 - (45%) Gaps:46/328 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LTDDAIVHSVNSIHRLGWSARKYDQWWGRKYSEGLKLRLGTKEPTYRVKAMTRLK--------NP 183
            |..|..:..|.|..:.....|.:|    ...:||...||....|.....|:...:        |.
  Fly    23 LLSDEFIEVVRSKAKTWTVGRNFD----ASVTEGHIRRLMGVHPDAHKFALPDKREVLGDLYVNS 83

  Fly   184 TDGLPSSFNALDKWSS--YISEVPDQGWCGASWVLSTTSVASDRFAIQSKGKENVQLSAQNILSC 246
            .|.||..|::..:|.:  .|.|:.|||.||:.|........|||..|.|.||.|...||.:::||
  Fly    84 VDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSC 148

  Fly   247 TRR-QQGCEGGHLDAAWRYLHKKGVV-------DENCYPY----TQH-----RDTCKIRHNSRSL 294
            ... ..||.||...|||.|..:||:|       ::.|.||    .:|     |..|  .|..|:.
  Fly   149 CHTCGFGCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPC--AHGGRTP 211

  Fly   295 R-ANGCQKPVNVD--RDSLYTVGPAYSLNREA-DIMAEIFHSGPVQATMRVNRDFFAYSGGVYRE 355
            : ::.||....||  :|..:. ..:||:.|.. :|..||..:|||:....|..|...|..|||:.
  Fly   212 KCSHVCQSGYTVDYAKDKHFG-SKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVYQH 275

  Fly   356 TAANRKAPTGFHSVKLVGWGEEHNGEK---YWIAANSWGSWWGEHGYFRILRGSNECGIEEYVLA 417
            .....   .|.|:::::|||..  ||:   ||:..|||.:.||:||:||||||.:.||||..:.|
  Fly   276 EHGKE---LGGHAIRILGWGVW--GEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGIESSISA 335

  Fly   418 SWP 420
            ..|
  Fly   336 GLP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SwimNP_611652.2 Somatomedin_B 41..83 CDD:279385
VWC 91..>126 CDD:302663
Peptidase_C1A_CathepsinB 188..417 CDD:239111 88/254 (35%)
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 10/43 (23%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 88/255 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452966
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.