DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swim and cpr-8

DIOPT Version :9

Sequence 1:NP_611652.2 Gene:Swim / 37537 FlyBaseID:FBgn0034709 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_503384.1 Gene:cpr-8 / 178613 WormBaseID:WBGene00021070 Length:335 Species:Caenorhabditis elegans


Alignment Length:350 Identity:107/350 - (30%)
Similarity:158/350 - (45%) Gaps:66/350 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 CLEGGSVQCDEDLCLTDDAIVHSVNSIHRLGWSARKYDQWWGRKYSEGL-KLRLGTKEPTYRVKA 176
            ||.|...|.|.......|.|:|.||| .:..|:|             |: .|...:...|....|
 Worm     7 CLIGVLFQADGVPPSEIDRIIHYVNS-QKTTWTA-------------GIPALSRNSMLKTLVTDA 57

  Fly   177 MT---RLKN-----PTDGLPSSFNALDKWSSYIS--EVPDQGWCGASWVLSTTSVASDRFAIQSK 231
            .|   :::|     ....|..||:|.::|...:|  ::.|...|..||..:.....|||..|.|.
 Worm    58 ATIGFKIQNFGVSQANSDLSPSFDARERWPECMSIPQINDISECKTSWAFAAAESMSDRLCINSG 122

  Fly   232 GKENVQLSAQNILSCTRRQ----QGCEGGHLDAAWRYLHKKGV-------VDENCYPY------- 278
            |.:|..|||:.:|||....    :|||||:...||:|:.|.|:       ....|.||       
 Worm   123 GFKNTILSAEELLSCCTGMFSCGEGCEGGNPFKAWQYIQKHGIPTGGSYESQFGCKPYSIPPCGK 187

  Fly   279 -------------TQHRDTCKIRHNSRSLRANGCQKPVNVDRDSLYTVGPAYSLNREADIMAEIF 330
                         |....:|:.:..||      ...|:::|:|..|.|......|.:.:|.:::.
 Worm   188 TVGNVTYPACTNTTSPTPSCEKKCTSR------IGYPIDIDKDRHYGVSVDQLPNSQIEIQSDVM 246

  Fly   331 HSGPVQATMRVNRDFFAYSGGVYRETAANRKAPTGFHSVKLVGWGEEHNGEKYWIAANSWGSWWG 395
            .:||:|||..|..||..|:.|:|.....|::   |..||:::||| ...|..||:.|||||..||
 Worm   247 LNGPIQATFEVYDDFLQYTTGIYVHLTGNKQ---GHLSVRIIGWG-VWQGVPYWLCANSWGRQWG 307

  Fly   396 EHGYFRILRGSNECGIEEYVLASWP 420
            |:|.||:|||:||||:|...::..|
 Worm   308 ENGTFRVLRGTNECGLESNCVSGMP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SwimNP_611652.2 Somatomedin_B 41..83 CDD:279385
VWC 91..>126 CDD:302663 5/12 (42%)
Peptidase_C1A_CathepsinB 188..417 CDD:239111 86/261 (33%)
cpr-8NP_503384.1 Propeptide_C1 24..>40 CDD:369701 8/29 (28%)
Peptidase_C1A_CathepsinB 79..330 CDD:239111 86/260 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3776
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.