DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swim and CTSW

DIOPT Version :9

Sequence 1:NP_611652.2 Gene:Swim / 37537 FlyBaseID:FBgn0034709 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001326.3 Gene:CTSW / 1521 HGNCID:2546 Length:376 Species:Homo sapiens


Alignment Length:333 Identity:84/333 - (25%)
Similarity:128/333 - (38%) Gaps:79/333 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 DAIVHSVNSIHRL----------------GWSARKYDQWWGRKYSEGLKLRLGTKEPTYRVKAMT 178
            |...|::....||                ..:..::.|.:|.:.:.|....:|.:         .
Human    64 DIFAHNLAQAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGRE---------I 119

  Fly   179 RLKNPTDGLPSSFNALDKW---SSYISEVPDQGWCGASWVLSTTSVASDRFAIQSKGKENVQLSA 240
            |.:.|.:.:|.|.:    |   :|.||.:.||..|...|.::........:.|..  .:.|.:|.
Human   120 RSEEPEESVPFSCD----WRKVASAISPIKDQKNCNCCWAMAAAGNIETLWRISF--WDFVDVSV 178

  Fly   241 QNILSCTRRQQGCEGGHL-DAAWRYLHKKGVVDENCYPYTQHRDTCKIRHNSRSLRANGC----- 299
            |.:|.|.|...||.||.: ||....|:..|:..|..||:            ...:||:.|     
Human   179 QELLDCGRCGDGCHGGFVWDAFITVLNNSGLASEKDYPF------------QGKVRAHRCHPKKY 231

  Fly   300 QKPVNVDRDSLYTVGPAYSLNREADIMAEIFHSGPVQATMRVNRDFFAYSGGVYRETAANRKAPT 364
            ||...: :|.:..      .|.|..|...:...||:..|:.: :....|..||.:.|........
Human   232 QKVAWI-QDFIML------QNNEHRIAQYLATYGPITVTINM-KPLQLYRKGVIKATPTTCDPQL 288

  Fly   365 GFHSVKLVGWGEEHNGE-------------------KYWIAANSWGSWWGEHGYFRILRGSNECG 410
            ..|||.|||:|...:.|                   .|||..||||:.|||.||||:.||||.||
Human   289 VDHSVLLVGFGSVKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSNTCG 353

  Fly   411 IEEYVLAS 418
            |.::.|.:
Human   354 ITKFPLTA 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SwimNP_611652.2 Somatomedin_B 41..83 CDD:279385
VWC 91..>126 CDD:302663
Peptidase_C1A_CathepsinB 188..417 CDD:239111 73/256 (29%)
CTSWNP_001326.3 Inhibitor_I29 42..98 CDD:214853 4/33 (12%)
Peptidase_C1A 129..358 CDD:239068 73/254 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149683
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.