DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swim and CTSL

DIOPT Version :9

Sequence 1:NP_611652.2 Gene:Swim / 37537 FlyBaseID:FBgn0034709 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001244900.1 Gene:CTSL / 1514 HGNCID:2537 Length:333 Species:Homo sapiens


Alignment Length:376 Identity:90/376 - (23%)
Similarity:153/376 - (40%) Gaps:83/376 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 SFCIGEVDPIISCEHNGVYFSKYNTTWDNCNECRCLEGGSVQCDEDLCLTDDAIVHSVNSIHRLG 143
            :||:|.....::.:|:   .....|.|                        .|:.:.:..::..|
Human     9 AFCLGIASATLTFDHS---LEAQWTKW------------------------KAMHNRLYGMNEEG 46

  Fly   144 WSARKYD------QWWGRKYSEG---LKLRLG-----TKEPTYRVKAMTRLKNPTDG-------- 186
            |....::      :...::|.||   ..:.:.     |.|...:|....:.:.|..|        
Human    47 WRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLF 111

  Fly   187 --LPSSFNALDKWSSYISEVPDQGWCGASWVLSTTSVASDRFAIQSKGKENVQLSAQNILSCTRR 249
              .|.|.:..:|  .|::.|.:||.||:.|..|.|.....:. .:..|: .:.||.||::.|:..
Human   112 YEAPRSVDWREK--GYVTPVKNQGQCGSCWAFSATGALEGQM-FRKTGR-LISLSEQNLVDCSGP 172

  Fly   250 Q--QGCEGGHLDAAWRYLHKKGVVD-ENCYPYTQHRDTCKIRHNSRSLRANGCQKPVNVDRDSLY 311
            |  :||.||.:|.|::|:...|.:| |..|||....::||  :|.:...||          |:.:
Human   173 QGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCK--YNPKYSVAN----------DTGF 225

  Fly   312 TVGPAYSLNREADIMAEIFHSGPVQATMRVNRD-FFAYSGGVYRETAANRKAPTGFHSVKLVGWG 375
            ...|    .:|..:|..:...||:...:....: |..|..|:|.|...:.:...  |.|.:||:|
Human   226 VDIP----KQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMD--HGVLVVGYG 284

  Fly   376 ---EEHNGEKYWIAANSWGSWWGEHGYFRILRG-SNECGIEEYVLASWPYV 422
               .|.:..|||:..||||..||..||.::.:. .|.|||..  .||:|.|
Human   285 FESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIAS--AASYPTV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SwimNP_611652.2 Somatomedin_B 41..83 CDD:279385 2/3 (67%)
VWC 91..>126 CDD:302663 3/34 (9%)
Peptidase_C1A_CathepsinB 188..417 CDD:239111 69/236 (29%)
CTSLNP_001244900.1 Inhibitor_I29 29..87 CDD:214853 9/81 (11%)
Peptidase_C1 114..332 CDD:395062 71/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149686
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.