DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and SPOP

DIOPT Version :10

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_003554.1 Gene:SPOP / 8405 HGNCID:11254 Length:374 Species:Homo sapiens


Alignment Length:104 Identity:38/104 - (36%)
Similarity:61/104 - (58%) Gaps:4/104 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LGRRYGQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEIEIHDISSA 82
            |....|.|...:::|||...|..::.:.||.||::.||||.|||...|:.:: :..:||:|:...
Human   186 LADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESK-KNRVEINDVEPE 249

  Fly    83 IFKVLVEYIYTGVVDYNGLELVACIELYYAAEKYLLEEL 121
            :||.::.:||||...  .|:.:| .:|..||:||.||.|
Human   250 VFKEMMCFIYTGKAP--NLDKMA-DDLLAAADKYALERL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB_POZ_ZBTB_KLHL-like 31..116 CDD:349497 30/84 (36%)
SPOPNP_003554.1 MATH_SPOP 28..166 CDD:239743
Required for nuclear localization 71..191 1/4 (25%)
Important for binding substrate proteins 123..133
BTB_POZ_SPOP-like 182..301 CDD:349588 38/104 (37%)
Important for homodimerization 186..217 9/30 (30%)
BACK_SPOP 297..367 CDD:350593
Important for homodimerization 297..355
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.