DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and AT4G08455

DIOPT Version :9

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_680660.3 Gene:AT4G08455 / 826404 AraportID:AT4G08455 Length:270 Species:Arabidopsis thaliana


Alignment Length:223 Identity:54/223 - (24%)
Similarity:84/223 - (37%) Gaps:60/223 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VSSGLGRRYGQLLRGAKYTDCVFHVCEEQ-----VKCHKLILSSASPVFEAMFFGPMQNNEPEPE 73
            :||.|.  :|.......:||.|....|:.     :..||.:|.|.||||:||.     .||.|..
plant    75 LSSSLD--HGTSSTSRSFTDVVLIASEDNAGSPPIPAHKSVLVSRSPVFKAML-----ENEMEES 132

  Fly    74 ----IEIHDISSAIFKVLVEYIYTGVVDYNGLELVACIELYYAAEKYLLEELIADTLMVITRKLR 134
                |:|.|:|....:..|.|:||.         .||           |:|.:|..|:|::.|.:
plant   133 LSGTIKISDVSYDALRTFVYYLYTA---------EAC-----------LDEQMACDLLVMSEKYQ 177

  Fly   135 FANILPALELSVCMGLDGLLEVCMTFFMRCCVNNGQYMSHLKEHYVHVSKECVKAIIAACKEPHK 199
            ..:               |...|..|.:.....:...|::...|. |.:|..:.|.::...|...
plant   178 VKH---------------LKSYCERFLVTKLSPDNSLMTYAFAHQ-HNAKHVLDAALSQIVENMD 226

  Fly   200 LLIWYVYEWTRQECEQLGLGPSDADLVV 227
            .|       |::| |.:.|...|..|:|
plant   227 KL-------TKRE-EYMELVEKDPRLIV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB 22..122 CDD:279045 30/108 (28%)
BTB 33..122 CDD:197585 28/97 (29%)
AT4G08455NP_680660.3 BTB_POZ_ZBTB_KLHL-like 90..176 CDD:349497 32/110 (29%)
BACK 194..248 CDD:350515 14/62 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24413
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.