DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and BPM2

DIOPT Version :10

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_566275.1 Gene:BPM2 / 819793 AraportID:AT3G06190 Length:406 Species:Arabidopsis thaliana


Alignment Length:201 Identity:59/201 - (29%)
Similarity:89/201 - (44%) Gaps:46/201 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SGLGRRYGQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAMFFGPMQNNEPEPEIEIHDIS 80
            ||||:::|:||...|..|..|.|..|....|||:|::.|.||.|..|||:: :|....|.|.|:.
plant   186 SGLGQQFGKLLESGKGADVTFEVDGETFPAHKLVLAARSAVFRAQLFGPLR-SENTNCIIIEDVQ 249

  Fly    81 SAIFKVLVEYIY----TGVVDYNGLEL-----VACIELYYAAEKYLLEEL--------------- 121
            :.|||:|:.:||    ..:.|..|.:|     :....|..||::|.||.|               
plant   250 APIFKMLLHFIYWDEMPDMQDLIGTDLKWASTLVAQHLLAAADRYALERLRTICESKLCEGISIN 314

  Fly   122 -IADTLMVITRK---------LRF----ANILPALELSVCMGLDGLLEVCMTFFMRCCVNNGQYM 172
             :|.||.:..:.         |:|    .|:...:|..   |.|.|.|.|.:......    :|:
plant   315 TVATTLALAEQHHCFQLKAACLKFIALPENLKAVMETD---GFDYLKESCPSLLSELL----EYV 372

  Fly   173 SHLKEH 178
            :.|.||
plant   373 ARLSEH 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB_POZ_ZBTB_KLHL-like 31..116 CDD:349497 31/93 (33%)
BPM2NP_566275.1 MATH 33..166 CDD:238068
BTB_POZ_BPM_plant 188..308 CDD:349589 41/120 (34%)
BACK_AtBPM-like 308..371 CDD:350516 12/69 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.