DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11275 and Tdpoz9

DIOPT Version :9

Sequence 1:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001157202.1 Gene:Tdpoz9 / 668359 MGIID:3702970 Length:365 Species:Mus musculus


Alignment Length:218 Identity:62/218 - (28%)
Similarity:97/218 - (44%) Gaps:51/218 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LGRRY----------------------GQLLRGAKYTDCVFHVCEEQVKCHKLILSSASPVFEAM 60
            |||:|                      |:|...:.:|||...|...:.:.||.||::.||||.||
Mouse   152 LGRKYNMPSQNITPAIKDPRHLLTDDLGELWENSLFTDCCLLVAGHEFRAHKAILAARSPVFRAM 216

  Fly    61 FFGPMQNNEPEPEIEIHDISSAIFKVLVEYIYTGVVDYNGLELVACIELYYAAEKY-------LL 118
            |...|:.:...| |:||:::..:||.::.:||||...|.....:|| ::..||:||       |.
Mouse   217 FEHEMKESLKTP-IKIHNLNPQVFKEMMSFIYTGKAPYLHSHSMAC-DVLPAADKYGLVSLKVLC 279

  Fly   119 EELIADTLMV--ITRKLRFANILPALELSVCMGLDGLL----EVCMTFFMRCCVNNGQYMSHLKE 177
            |:.....|.|  .|..|..|: |.:.|......||.:.    |||.|         .::.|.::.
Mouse   280 EDAFCRNLSVKNATHTLILAD-LHSTEKLKTQALDFIAYYASEVCET---------SEWKSMVES 334

  Fly   178 HYVHVSKECVKAIIAA-CK--EP 197
            | .|:..|..:::.:| |.  ||
Mouse   335 H-PHLVAEAFQSLASAQCSFLEP 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11275NP_611649.1 BTB 22..122 CDD:279045 38/128 (30%)
BTB 33..122 CDD:197585 34/95 (36%)
Tdpoz9NP_001157202.1 MATH 16..154 CDD:295307 1/1 (100%)
BTB 178..284 CDD:279045 37/107 (35%)
BTB 189..287 CDD:197585 34/99 (34%)
SPOP_C 287..349 CDD:269807 17/72 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24413
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X131
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.